Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LGI1. Target Synonyms: Epitempin-1. Accession Number: O95970. Expression Region: 224~557aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 46.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial is a purified Recombinant Protein.

Accession Number

O95970

Expression Region

224~557aa

Host

E. coli

Target

LGI1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Epitempin-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Ankyrin repeat domain-containing protein 13D (ANKRD13D) ELISA Kit
MBS7240430-01 48 Well

Rabbit Ankyrin repeat domain-containing protein 13D (ANKRD13D) ELISA Kit

Sign In for Pricing
View Details
Rabbit Ankyrin repeat domain-containing protein 13D (ANKRD13D) ELISA Kit
MBS7240430-02 96 Well

Rabbit Ankyrin repeat domain-containing protein 13D (ANKRD13D) ELISA Kit

Sign In for Pricing
View Details
Rabbit Ankyrin repeat domain-containing protein 13D (ANKRD13D) ELISA Kit
MBS7240430-03 5x 96 Well

Rabbit Ankyrin repeat domain-containing protein 13D (ANKRD13D) ELISA Kit

Sign In for Pricing
View Details
Rabbit Ankyrin repeat domain-containing protein 13D (ANKRD13D) ELISA Kit
MBS7240430-04 10x 96 Well

Rabbit Ankyrin repeat domain-containing protein 13D (ANKRD13D) ELISA Kit

Sign In for Pricing
View Details
COL6A2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV650753 1.0 µg DNA

COL6A2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Rad51ap1 (NM_001079711) Rat Tagged Lenti ORF Clone
RR210136L4 10 µg

Rad51ap1 (NM_001079711) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details