Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LGI1. Target Synonyms: Epitempin-1. Accession Number: O95970. Expression Region: 224~557aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 46.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial is a purified Recombinant Protein.

Accession Number

O95970

Expression Region

224~557aa

Host

E. coli

Target

LGI1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Epitempin-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ARL3 Antibody (OTI1C6) [DyLight 650]
NBP2-70206C 0.1 mL

Mouse Monoclonal ARL3 Antibody (OTI1C6) [DyLight 650]

Sign In for Pricing
View Details
NOS2 (NOS2A, Nitric Oxide Synthase, Inducible, Hepatocyte NOS, Inducible NO Synthase, NOS Type II, Peptidyl-cysteine S-nitrosylase NOS2) (FITC)
130473-FITC 100 µL

NOS2 (NOS2A, Nitric Oxide Synthase, Inducible, Hepatocyte NOS, Inducible NO Synthase, NOS Type II, Peptidyl-cysteine S-nitrosylase NOS2) (FITC)

Sign In for Pricing
View Details
Psmc2 (NM_033236) Rat Tagged ORF Clone Lentiviral Particle
RR204098L4V 200 µL

Psmc2 (NM_033236) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human LOX-1/OLR1 Alexa Fluor 750 Antibody (Clone 331212)
FAB1798S-100UG 100 µg

Human LOX-1/OLR1 Alexa Fluor 750 Antibody (Clone 331212)

Sign In for Pricing
View Details
HOXB1 (Homeobox B1, HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845) (MaxLight 750)
MBS6238738-01 0.1 mL

HOXB1 (Homeobox B1, HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845) (MaxLight 750)

Sign In for Pricing
View Details
HOXB1 (Homeobox B1, HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845) (MaxLight 750)
MBS6238738-02 5x 0.1 mL

HOXB1 (Homeobox B1, HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845) (MaxLight 750)

Sign In for Pricing
View Details