Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LGI1. Target Synonyms: Epitempin-1. Accession Number: O95970. Expression Region: 224~557aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 46.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial is a purified Recombinant Protein.

Accession Number

O95970

Expression Region

224~557aa

Host

E. coli

Target

LGI1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Epitempin-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCB7, CT (ATP-binding Cassette Sub-family B Member 7, Mitochondrial, ATP-binding Cassette Transporter 7, ABC Transporter 7 Protein, ABC7) (MaxLight 550) discontinued
A0004-01H-ML550 100 µL

ABCB7, CT (ATP-binding Cassette Sub-family B Member 7, Mitochondrial, ATP-binding Cassette Transporter 7, ABC Transporter 7 Protein, ABC7) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Human T-complex protein 1 subunit theta (CCT8)
MBS955861-01 0.02 mg (E-Coli)

Recombinant Human T-complex protein 1 subunit theta (CCT8)

Sign In for Pricing
View Details
Recombinant Human T-complex protein 1 subunit theta (CCT8)
MBS955861-02 0.02 mg (Yeast)

Recombinant Human T-complex protein 1 subunit theta (CCT8)

Sign In for Pricing
View Details
Recombinant Human T-complex protein 1 subunit theta (CCT8)
MBS955861-03 0.1 mg (E-Coli)

Recombinant Human T-complex protein 1 subunit theta (CCT8)

Sign In for Pricing
View Details
Recombinant Human T-complex protein 1 subunit theta (CCT8)
MBS955861-04 0.1 mg (Yeast)

Recombinant Human T-complex protein 1 subunit theta (CCT8)

Sign In for Pricing
View Details
Recombinant Human T-complex protein 1 subunit theta (CCT8)
MBS955861-05 0.02 mg (Baculovirus)

Recombinant Human T-complex protein 1 subunit theta (CCT8)

Sign In for Pricing
View Details