Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LGI1. Target Synonyms: Epitempin-1. Accession Number: O95970. Expression Region: 224~557aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 46.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial is a purified Recombinant Protein.

Accession Number

O95970

Expression Region

224~557aa

Host

E. coli

Target

LGI1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Epitempin-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC00276 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV731189 1.0 µg DNA

LINC00276 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (AP)
MBS6403489-01 0.1 mL

Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (AP)

Sign In for Pricing
View Details
Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (AP)
MBS6403489-02 5x 0.1 mL

Eotaxin (CCL11, C-C Motif Chemokine 11, Eosinophil Chemotactic Protein, Small-inducible Cytokine A11, SCYA11, MGC22554) (AP)

Sign In for Pricing
View Details
Weighing dishes, black, rhombus-type, 30 ml, 78 x 56 x 14 mm
1211808 500 PCS/PCK

Weighing dishes, black, rhombus-type, 30 ml, 78 x 56 x 14 mm

Sign In for Pricing
View Details
POLR2E (NM_002695) Human Over-expression Lysate
LS005434-100ug 100 µg

POLR2E (NM_002695) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human BRD2 Protein, N-His
YHD67101 100 μg

Recombinant Human BRD2 Protein, N-His

Sign In for Pricing
View Details