Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein L1 (L1R), partial

Recombinant Vaccinia virus Protein L1 (L1R), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain Copenhagen) (VACV) . Target Name: L1R. Target Synonyms: Virion membrane protein M25. Accession Number: P20540. Expression Region: 2~183aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Vaccinia virus Protein L1 (L1R), partial is a purified Recombinant Protein.

Accession Number

P20540

Expression Region

2~183aa

Host

E. coli

Target

L1R

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Virion membrane protein M25

Species

Vaccinia virus (strain Copenhagen) (VACV)

Protein Name

Recombinant Protein

AA Sequence

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNNBIP1 (Beta-catenin-interacting Protein 1, Inhibitor of beta-catenin and Tcf-4, ICAT, MGC15093) (APC)
125456-APC 100 µL

CTNNBIP1 (Beta-catenin-interacting Protein 1, Inhibitor of beta-catenin and Tcf-4, ICAT, MGC15093) (APC)

Sign In for Pricing
View Details
PE-Cyanine7 Anti-Human CD11b (ICRF44)
orb1215195-01 25 Tests

PE-Cyanine7 Anti-Human CD11b (ICRF44)

Sign In for Pricing
View Details
PE-Cyanine7 Anti-Human CD11b (ICRF44)
orb1215195-02 100 Tests

PE-Cyanine7 Anti-Human CD11b (ICRF44)

Sign In for Pricing
View Details
PSMB10 Antibody (C-term) Blocking peptide
MBS9219234-01 0.5 mg

PSMB10 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
PSMB10 Antibody (C-term) Blocking peptide
MBS9219234-02 5x 0.5 mg

PSMB10 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
Monkey 5'-Nucleotidase / CD73 (NT5E) ELISA Kit
abx354957 96 Well

Monkey 5'-Nucleotidase / CD73 (NT5E) ELISA Kit

Sign In for Pricing
View Details