Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine polyomavirus Minor capsid protein VP2

Recombinant Murine polyomavirus Minor capsid protein VP2 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Murine polyomavirus (strain Kilham) (MPyV) (Murine pneumotropic virus) . Target Name: Murine polyomavirus Minor capsid protein VP2. Target Synonyms: Minor structural protein VP2. Accession Number: P24596. Expression Region: 2~324aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 41.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Murine polyomavirus Minor capsid protein VP2 is a purified Recombinant Protein.

Accession Number

P24596

Expression Region

2~324aa

Host

E. coli

Target

Murine polyomavirus Minor capsid protein VP2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Minor structural protein VP2

Species

Murine polyomavirus (strain Kilham) (MPyV) (Murine pneumotropic virus)

Protein Name

Recombinant Protein

AA Sequence

GAFLAVLAEVFDLASITGLSVESILSGEALTTAELLQSHINNLVVYGGLTEAEALAAVEVTPQAFAALTSLFPNFPQALGALAATEFTATGALTVGAAVSAALYPYYWDYRTPVADLNMALQIWYPDLDILFPGALPFARFVNYIDPANWAADLYRAVGRYFWERVQAAGINFIEQQMETGRELAMRSVTSLSETLSQYFENARWAVSGLSTSLYHGLESYYSQLGLSPIQQRQLARNLGHPQPYRYDLYDAPQLKGQVSATYVTKVDPPGGANQRSAPDWMLPLLLGLYGDLTPSWKDTLEELEAEEDGSHSQKAKRRKTKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® N T
N30002-4.1G 1 g

TentaGel® N T

Sign In for Pricing
View Details
RPL27
CSB-CL020213HU2 10 μg Plasmid + 200 μL Glycerol

RPL27

Sign In for Pricing
View Details
GLT25D2 (COLGALT2) Rabbit Polyclonal Antibody
TA331966 100 µL

GLT25D2 (COLGALT2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OAMA00176-1MG - Mycobacterium avium Antibody
OAMA00176-1MG 1 mg

OAMA00176-1MG - Mycobacterium avium Antibody

Sign In for Pricing
View Details
SHPK Antibody
CSB-PA833951 100 µL

SHPK Antibody

Sign In for Pricing
View Details
Mouse Monoclonal HPx1 Antibody (HIC0-3B3) [Janelia Fluor 646]
NBP1-18951JF646 0.1 mL

Mouse Monoclonal HPx1 Antibody (HIC0-3B3) [Janelia Fluor 646]

Sign In for Pricing
View Details