Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine polyomavirus Minor capsid protein VP2

Recombinant Murine polyomavirus Minor capsid protein VP2 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Murine polyomavirus (strain Kilham) (MPyV) (Murine pneumotropic virus) . Target Name: Murine polyomavirus Minor capsid protein VP2. Target Synonyms: Minor structural protein VP2. Accession Number: P24596. Expression Region: 2~324aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 41.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Murine polyomavirus Minor capsid protein VP2 is a purified Recombinant Protein.

Accession Number

P24596

Expression Region

2~324aa

Host

E. coli

Target

Murine polyomavirus Minor capsid protein VP2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Minor structural protein VP2

Species

Murine polyomavirus (strain Kilham) (MPyV) (Murine pneumotropic virus)

Protein Name

Recombinant Protein

AA Sequence

GAFLAVLAEVFDLASITGLSVESILSGEALTTAELLQSHINNLVVYGGLTEAEALAAVEVTPQAFAALTSLFPNFPQALGALAATEFTATGALTVGAAVSAALYPYYWDYRTPVADLNMALQIWYPDLDILFPGALPFARFVNYIDPANWAADLYRAVGRYFWERVQAAGINFIEQQMETGRELAMRSVTSLSETLSQYFENARWAVSGLSTSLYHGLESYYSQLGLSPIQQRQLARNLGHPQPYRYDLYDAPQLKGQVSATYVTKVDPPGGANQRSAPDWMLPLLLGLYGDLTPSWKDTLEELEAEEDGSHSQKAKRRKTKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ovine 12-Hydroxyeicosatetraenoic Acid (12-HETE) ELISA Kit-Competitive
EK1F781 96 Tests

Ovine 12-Hydroxyeicosatetraenoic Acid (12-HETE) ELISA Kit-Competitive

Sign In for Pricing
View Details
Sex Hormone Binding Globulin (SHBG) Antibody
orb1712784 0.1 mL

Sex Hormone Binding Globulin (SHBG) Antibody

Sign In for Pricing
View Details
MED30 (NM_080651) Human Over-expression Lysate
LS090390 100 µg

MED30 (NM_080651) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Geobacter sp. Protein MraZ (mraZ)
MBS1139182-01 0.02 mg (E-Coli)

Recombinant Geobacter sp. Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Protein MraZ (mraZ)
MBS1139182-02 0.1 mg (E-Coli)

Recombinant Geobacter sp. Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Protein MraZ (mraZ)
MBS1139182-03 0.02 mg (Yeast)

Recombinant Geobacter sp. Protein MraZ (mraZ)

Sign In for Pricing
View Details