Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog (KA3L), partial

Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog (KA3L), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus) . Target Name: KA3L. Accession Number: P52539. Expression Region: 135~364aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 34.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog (KA3L), partial is a purified Recombinant Protein.

Accession Number

P52539

Expression Region

135~364aa

Host

E. coli

Target

KA3L

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Protein Name

Recombinant Protein

AA Sequence

CLLTNDILETDLLLRYRQCLDSLTREENQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVNPQDLFMYTITVMKFEFFNKLNMAKLTCVFNDNGHGDIEYRKLRQLCGKPVLDREMPNSEFEVQQQTPDSFRHPIQQAMSIVVTFARILRQIKEHIIRTKKPQFIRDFDTERVAERYECGLISRLIGKQFSNHKCDDVSCQNRIERIMAPWKPSLFFCTYF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cited2 shRNA (UAS) - Lentiviral mouse Cited2 shRNA (UAS) (100)
GTR15160746 1 Vial

Lentiviral mouse Cited2 shRNA (UAS) - Lentiviral mouse Cited2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Human Monoclonal MIS RII/AMHR2 Antibody (murlentamab) [CoraFluor 1]
NBP3-28773CL1 0.1 mL

Human Monoclonal MIS RII/AMHR2 Antibody (murlentamab) [CoraFluor 1]

Sign In for Pricing
View Details
ACAD9 (NM_014049) Human 3' UTR Clone
SC207243 10 µg

ACAD9 (NM_014049) Human 3' UTR Clone

Sign In for Pricing
View Details
Spx (NM_001083933) Rat Tagged ORF Clone Lentiviral Particle
RR202031L3V 200 µL

Spx (NM_001083933) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human CDX4 shRNA (UAS) - Lentiviral human CDX4 shRNA (UAS, GFP) plasmid
GTR15314197 1 Vial

Lentiviral human CDX4 shRNA (UAS) - Lentiviral human CDX4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
FBXO22 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
20316061 1.0 µg DNA

FBXO22 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details