Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog (KA3L), partial

Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog (KA3L), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus) . Target Name: KA3L. Accession Number: P52539. Expression Region: 135~364aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 34.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog (KA3L), partial is a purified Recombinant Protein.

Accession Number

P52539

Expression Region

135~364aa

Host

E. coli

Target

KA3L

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Protein Name

Recombinant Protein

AA Sequence

CLLTNDILETDLLLRYRQCLDSLTREENQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVNPQDLFMYTITVMKFEFFNKLNMAKLTCVFNDNGHGDIEYRKLRQLCGKPVLDREMPNSEFEVQQQTPDSFRHPIQQAMSIVVTFARILRQIKEHIIRTKKPQFIRDFDTERVAERYECGLISRLIGKQFSNHKCDDVSCQNRIERIMAPWKPSLFFCTYF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG384.1 homolog (MPN_565), partial
MBS7058408 Inquire

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG384.1 homolog (MPN_565), partial

Sign In for Pricing
View Details
Awat2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3639808 1.0 µg DNA

Awat2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Acridine Orange
abx082207 5 g

Acridine Orange

Sign In for Pricing
View Details
Alizarin red S, Practical grade
GRM894-100G 1 unit

Alizarin red S, Practical grade

Sign In for Pricing
View Details
Calcipressin 1/DSCR 1 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62559R-APC-Cy5.5 100 µL

Calcipressin 1/DSCR 1 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal DNMT1 Antibody [Alexa Fluor 647]
NB100-392AF647 0.1 mL

Rabbit Polyclonal DNMT1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details