Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog (KA3L), partial

Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog (KA3L), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus) . Target Name: KA3L. Accession Number: P52539. Expression Region: 135~364aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 34.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human herpesvirus 6B mRNA export factor ICP27 homolog (KA3L), partial is a purified Recombinant Protein.

Accession Number

P52539

Expression Region

135~364aa

Host

E. coli

Target

KA3L

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Protein Name

Recombinant Protein

AA Sequence

CLLTNDILETDLLLRYRQCLDSLTREENQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVNPQDLFMYTITVMKFEFFNKLNMAKLTCVFNDNGHGDIEYRKLRQLCGKPVLDREMPNSEFEVQQQTPDSFRHPIQQAMSIVVTFARILRQIKEHIIRTKKPQFIRDFDTERVAERYECGLISRLIGKQFSNHKCDDVSCQNRIERIMAPWKPSLFFCTYF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPDL Antibody - middle region
MBS3205339-01 0.1 mL

HNRNPDL Antibody - middle region

Sign In for Pricing
View Details
HNRNPDL Antibody - middle region
MBS3205339-02 5x 0.1 mL

HNRNPDL Antibody - middle region

Sign In for Pricing
View Details
ERLEC1 Human Pre-designed siRNA Set A
HY-RS04500 1 Set

ERLEC1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human ARHGEF18 Knockout A549 cell line
GTR15402667 1 Vial

Human ARHGEF18 Knockout A549 cell line

Sign In for Pricing
View Details
Mouse Monoclonal AE Binding Protein 1/ACLP Antibody (590831) [DyLight 550]
FAB6425L 0.1 mL

Mouse Monoclonal AE Binding Protein 1/ACLP Antibody (590831) [DyLight 550]

Sign In for Pricing
View Details
Zfp40 3'UTR Luciferase Stable Cell Line
TU223740 1.0 mL

Zfp40 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details