Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glutathione peroxidase 7 (Gpx7)

Recombinant Mouse Glutathione peroxidase 7 (Gpx7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Gpx7. Accession Number: Q99LJ6. Expression Region: 19~186aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Glutathione peroxidase 7 (Gpx7) is a purified Recombinant Protein.

Accession Number

Q99LJ6

Expression Region

19~186aa

Host

E. coli

Target

Gpx7

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQVMKLILRKREDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CSN1S1 Protein, N-His
YHE50801 100 μg

Recombinant Human CSN1S1 Protein, N-His

Sign In for Pricing
View Details
Cycloleucine
C01861-250mg 250 mg

Cycloleucine

Sign In for Pricing
View Details
TDP2 (Tyrosyl-DNA Phosphodiesterase 2, Tyr-DNA Phosphodiesterase 2, hTDP2, 5'-tyrosyl-DNA Phosphodiesterase, 5'-Tyr-DNA Phosphodiesterase, AD022, AD-022, ETS1-associated Protein 2, EAP2, ETS1-associated Protein II, EAPII, TRAF and TNF Receptor-associated Protein, TTRAP, Tyrosyl-RNA Phosphodiesterase, VPg Unlinkase) (MaxLight 650)
134873-ML650 100 µL

TDP2 (Tyrosyl-DNA Phosphodiesterase 2, Tyr-DNA Phosphodiesterase 2, hTDP2, 5'-tyrosyl-DNA Phosphodiesterase, 5'-Tyr-DNA Phosphodiesterase, AD022, AD-022, ETS1-associated Protein 2, EAP2, ETS1-associated Protein II, EAPII, TRAF and TNF Receptor-associated Protein, TTRAP, Tyrosyl-RNA Phosphodiesterase, VPg Unlinkase) (MaxLight 650)

Sign In for Pricing
View Details
Trim58 (NM_001039047) Mouse Untagged Clone
MC216610 10 µg

Trim58 (NM_001039047) Mouse Untagged Clone

Sign In for Pricing
View Details
TNFRSF10D Adenovirus (Human)
47200051 1.0 mL

TNFRSF10D Adenovirus (Human)

Sign In for Pricing
View Details
KRT5 Antibody
K49029M07G07C-01 50 ug

KRT5 Antibody

Sign In for Pricing
View Details