Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein mono-ADP-ribosyltransferase PARP14 (PARP14), partial

Recombinant Human Protein mono-ADP-ribosyltransferase PARP14 (PARP14), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PARP14. Target Synonyms: ADP-ribosyltransferase diphtheria toxin-like 8. Accession Number: Q460N5. Expression Region: 1605~1801aa. Tag Info: C-Terminal Hfc-Tagged. Theoretical MW: 51.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Protein mono-ADP-ribosyltransferase PARP14 (PARP14), partial is a purified Recombinant Protein.

Accession Number

Q460N5

Expression Region

1605~1801aa

Host

Mammalian Cells

Target

PARP14

Conjugation

Unconjugated

Tag

C-Terminal Hfc-Tagged

Field of Research

Primary Antibodies

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ADP-ribosyltransferase diphtheria toxin-like 8

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Common timothy PHLPI/Allergen Phl p I Protein, N-His
PR137012-01 50 µg

Recombinant Common timothy PHLPI/Allergen Phl p I Protein, N-His

Sign In for Pricing
View Details
Recombinant Common timothy PHLPI/Allergen Phl p I Protein, N-His
PR137012-02 100 µg

Recombinant Common timothy PHLPI/Allergen Phl p I Protein, N-His

Sign In for Pricing
View Details
Recombinant Common timothy PHLPI/Allergen Phl p I Protein, N-His
PR137012-03 1 mg

Recombinant Common timothy PHLPI/Allergen Phl p I Protein, N-His

Sign In for Pricing
View Details
Rabbit Monoclonal IL-32 Antibody (034) [mFluor Violet 450 SE]
NBP2-89776MFV450 0.1 mL

Rabbit Monoclonal IL-32 Antibody (034) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
PCID2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
36196151 3x 1.0 µg DNA

PCID2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Op18 Polyclonal Antibody
ABP52082-01 30 µL

Op18 Polyclonal Antibody

Sign In for Pricing
View Details