Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carboxypeptidase D (CPD), partial

Recombinant Human Carboxypeptidase D (CPD), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CPD. Target Synonyms: Metallocarboxypeptidase Dgp180. Accession Number: O75976. Expression Region: 383~461aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 12.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Carboxypeptidase D (CPD), partial is a purified Recombinant Protein.

Accession Number

O75976

Expression Region

383~461aa

Host

Baculovirus

Target

CPD

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

12.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Metallocarboxypeptidase Dgp180

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KKIAMRE (Cyclin-Dependent Kinase-like 2, Serine/threonine-Protein Kinase KKIAMRE, Protein Kinase p56 KKIAMRE, CDKL2) discontinued
223807-01 50 µL

KKIAMRE (Cyclin-Dependent Kinase-like 2, Serine/threonine-Protein Kinase KKIAMRE, Protein Kinase p56 KKIAMRE, CDKL2) discontinued

Sign In for Pricing
View Details
KKIAMRE (Cyclin-Dependent Kinase-like 2, Serine/threonine-Protein Kinase KKIAMRE, Protein Kinase p56 KKIAMRE, CDKL2) discontinued
223807-02 100 µL

KKIAMRE (Cyclin-Dependent Kinase-like 2, Serine/threonine-Protein Kinase KKIAMRE, Protein Kinase p56 KKIAMRE, CDKL2) discontinued

Sign In for Pricing
View Details
Anti-FLIPγ/δ (CT) Antibody
orb1149191 100 µg

Anti-FLIPγ/δ (CT) Antibody

Sign In for Pricing
View Details
Monocyte Chemotactic Protein-3 Human Recombinant (CCL7) (MCP 3 Human)
PT_41479-01 2 µg

Monocyte Chemotactic Protein-3 Human Recombinant (CCL7) (MCP 3 Human)

Sign In for Pricing
View Details
Monocyte Chemotactic Protein-3 Human Recombinant (CCL7) (MCP 3 Human)
PT_41479-02 10 µg

Monocyte Chemotactic Protein-3 Human Recombinant (CCL7) (MCP 3 Human)

Sign In for Pricing
View Details
Monocyte Chemotactic Protein-3 Human Recombinant (CCL7) (MCP 3 Human)
PT_41479-03 1 mg

Monocyte Chemotactic Protein-3 Human Recombinant (CCL7) (MCP 3 Human)

Sign In for Pricing
View Details