Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Platelet-activating factor acetylhydrolase (Pla2g7)

Recombinant Mouse Platelet-activating factor acetylhydrolase (Pla2g7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Pla2g7. Target Synonyms: 1-alkyl-2-acetylglycerophosphocholine esterase2-acetyl-1-alkylglycerophosphocholine esteraseLDL-associated phospholipase A2. Accession Number: Q60963. Expression Region: 22~440aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 50.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Platelet-activating factor acetylhydrolase (Pla2g7) is a purified Recombinant Protein.

Accession Number

Q60963

Expression Region

22~440aa

Host

Baculovirus

Target

Pla2g7

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1-alkyl-2-acetylglycerophosphocholine esterase2-acetyl-1-alkylglycerophosphocholine esteraseLDL-associated phospholipase A2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mammary carcinoma Marker-CA153) Mouse ELISA Kit
20470 96 Tests

Mammary carcinoma Marker-CA153) Mouse ELISA Kit

Sign In for Pricing
View Details
SPRR2B (NM_001017418) Human Tagged ORF Clone Lentiviral Particle
RC211827L3V 200 µL

SPRR2B (NM_001017418) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Shewanella baltica Tryptophan synthase beta chain (trpB)
MBS1026525-01 0.02 mg (E-Coli)

Recombinant Shewanella baltica Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Shewanella baltica Tryptophan synthase beta chain (trpB)
MBS1026525-02 0.02 mg (Yeast)

Recombinant Shewanella baltica Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Shewanella baltica Tryptophan synthase beta chain (trpB)
MBS1026525-03 0.1 mg (E-Coli)

Recombinant Shewanella baltica Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Shewanella baltica Tryptophan synthase beta chain (trpB)
MBS1026525-04 0.1 mg (Yeast)

Recombinant Shewanella baltica Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details