Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 11 protein E4 (E4)

Recombinant Human papillomavirus type 11 protein E4 (E4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human papillomavirus type 11. Target Name: E4. Accession Number: P04016. Expression Region: 1~90aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human papillomavirus type 11 protein E4 (E4) is a purified Recombinant Protein.

Accession Number

P04016

Expression Region

1~90aa

Host

E. coli

Target

E4

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human papillomavirus 11

Protein Name

Recombinant Protein

AA Sequence

MADDSALYEKYPLLNLLHTPPHRPPPLQCPPAPRKTACRRRLGSEHVDRPLTTPCVWPTSDPWTVQSTTSSLTITTSTKEGTTVTVQLRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Regenerating Islet Derived Protein 3 Alpha (REG3a) CLIA Kit
abx494690-01 96 Tests

Mouse Regenerating Islet Derived Protein 3 Alpha (REG3a) CLIA Kit

Sign In for Pricing
View Details
Mouse Regenerating Islet Derived Protein 3 Alpha (REG3a) CLIA Kit
abx494690-02 5x 96 Tests

Mouse Regenerating Islet Derived Protein 3 Alpha (REG3a) CLIA Kit

Sign In for Pricing
View Details
Mouse Regenerating Islet Derived Protein 3 Alpha (REG3a) CLIA Kit
abx494690-03 10x 96 Tests

Mouse Regenerating Islet Derived Protein 3 Alpha (REG3a) CLIA Kit

Sign In for Pricing
View Details
Laccase Assay Kit (Spectrophotometry)
CB0279S 50 Tests

Laccase Assay Kit (Spectrophotometry)

Sign In for Pricing
View Details
Lentiviral human SORL1 sgRNA gene knockout kit - Lentiviral human SORL1 sgRNA gene knockout kit (25)
GTR15382590 1 Vial

Lentiviral human SORL1 sgRNA gene knockout kit - Lentiviral human SORL1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Pfkp Mouse Gene Knockout Kit (CRISPR)
KN513145 1 Kit

Pfkp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details