Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein GLI1 (GLI1), partial

Recombinant Human Zinc finger protein GLI1 (GLI1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GLI1. Target Synonyms: Glioma-associated oncogeneOncogene GLI. Accession Number: P08151. Expression Region: 921~1106aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Zinc finger protein GLI1 (GLI1), partial is a purified Recombinant Protein.

Accession Number

P08151

Expression Region

921~1106aa

Host

E. coli

Target

GLI1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glioma-associated oncogeneOncogene GLI

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Axis Inhibition Protein 1 (AXIN1) Antibody (APC)
abx446476 100 µg

Axis Inhibition Protein 1 (AXIN1) Antibody (APC)

Sign In for Pricing
View Details
Histone H3.1t, NT (H3/g, H3t, H3/t, HIST3H3, H3FT) (FITC) discontinued
H5110-24T-FITC 200 µL

Histone H3.1t, NT (H3/g, H3t, H3/t, HIST3H3, H3FT) (FITC) discontinued

Sign In for Pricing
View Details
C6orf182 CRISPR Activation Plasmid (h)
sc-415439-ACT 20 µg

C6orf182 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Lentiviral mouse Pgam1 shRNA (UAS) - Lentiviral mouse Pgam1 shRNA (UAS, RFP) (100)
GTR15273516 1 Vial

Lentiviral mouse Pgam1 shRNA (UAS) - Lentiviral mouse Pgam1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Mouse CD151 antigen (Cd151), partial
MBS7054296 Inquire

Recombinant Mouse CD151 antigen (Cd151), partial

Sign In for Pricing
View Details
CAPZA1 Knockout A549 Polyclonal Cells
ARG42247 1 Million

CAPZA1 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details