Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 4 (Ccl4)

Recombinant Mouse C-C motif chemokine 4 (Ccl4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ccl4. Target Synonyms: Immune activation protein 2; ACT-2; ACT2Macrophage inflammatory protein 1-beta; MIP-1-betaProtein H400SIS-gamma; Small-inducible cytokine A4. Accession Number: P14097. Expression Region: 24~92aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 11.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse C-C motif chemokine 4 (Ccl4) is a purified Recombinant Protein.

Accession Number

P14097

Expression Region

24~92aa

Host

E. coli

Target

Ccl4

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Immune activation protein 2; ACT-2; ACT2Macrophage inflammatory protein 1-beta; MIP-1-betaProtein H400SIS-gamma; Small-inducible cytokine A4

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-500 1x 500 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-100 1x 100 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-500 1x 500 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF488A conjugate, 0.1mg/mL
BNC881975-500 1x 500 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Laminin (A5), CF594 conjugate, 0.1mg/mL
BNC940308-500 1x 500 µL

Laminin (A5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details