Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1), partial

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: BAM1. Target Synonyms: 1,4-alpha-D-glucan maltohydrolase (Beta-amylase 7; Thioredoxin-regulated beta-amylase; TR-BAMY; BMY7; TRBAMY) . Accession Number: Q9LIR6. Expression Region: 42~354aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 41.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1), partial is a purified Recombinant Protein.

Accession Number

Q9LIR6

Expression Region

42~354aa

Host

E. coli

Target

BAM1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 7; Thioredoxin-regulated beta-amylase; TR-BAMY; BMY7; TRBAMY)

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAETYGKPEWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGF, murine recombinant
7160-10 10 µg

HGF, murine recombinant

Sign In for Pricing
View Details
SOX7, CT (SOX7, Transcription factor SOX-7) (APC) discontinued
042176-APC 200 µL

SOX7, CT (SOX7, Transcription factor SOX-7) (APC) discontinued

Sign In for Pricing
View Details
HMG-3 CRISPR Activation Plasmid (m)
sc-420875-ACT 20 µg

HMG-3 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
VEGF121 Protein (C-His, Mouse)
P519197 100 µg

VEGF121 Protein (C-His, Mouse)

Sign In for Pricing
View Details
Mouse CD1 Vena Cava Total RNA
MR-908 0.025 mg

Mouse CD1 Vena Cava Total RNA

Sign In for Pricing
View Details
Lentiviral human NBPF4 shRNA (UAS) - Lentiviral human NBPF4 shRNA (UAS, RFP) (100)
GTR15330579 1 Vial

Lentiviral human NBPF4 shRNA (UAS) - Lentiviral human NBPF4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details