Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1), partial

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: BAM1. Target Synonyms: 1,4-alpha-D-glucan maltohydrolase (Beta-amylase 7; Thioredoxin-regulated beta-amylase; TR-BAMY; BMY7; TRBAMY) . Accession Number: Q9LIR6. Expression Region: 42~354aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 41.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1), partial is a purified Recombinant Protein.

Accession Number

Q9LIR6

Expression Region

42~354aa

Host

E. coli

Target

BAM1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 7; Thioredoxin-regulated beta-amylase; TR-BAMY; BMY7; TRBAMY)

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAETYGKPEWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ODF3 shRNA (UAS) - Lentiviral human ODF3 shRNA (UAS) plasmid
GTR15338674 1 Vial

Lentiviral human ODF3 shRNA (UAS) - Lentiviral human ODF3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
TAF9P1 3'UTR GFP Stable Cell Line
TU075096 1.0 mL

TAF9P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ccdc114 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3620305 3x 1.0 µg

Ccdc114 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal Herpes Simplex Virus 1 Antibody (HSVI/8375R) [Alexa Fluor 647]
NBP3-20741AF647 0.1 mL

Rabbit Monoclonal Herpes Simplex Virus 1 Antibody (HSVI/8375R) [Alexa Fluor 647]

Sign In for Pricing
View Details
Klra12 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3019102 1.0 µg DNA

Klra12 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rat Ncor1 Pre-designed siRNA Set A
SI209101A 1 Each

Rat Ncor1 Pre-designed siRNA Set A

Sign In for Pricing
View Details