Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1), partial

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: BAM1. Target Synonyms: 1,4-alpha-D-glucan maltohydrolase (Beta-amylase 7; Thioredoxin-regulated beta-amylase; TR-BAMY; BMY7; TRBAMY) . Accession Number: Q9LIR6. Expression Region: 42~354aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 41.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1), partial is a purified Recombinant Protein.

Accession Number

Q9LIR6

Expression Region

42~354aa

Host

E. coli

Target

BAM1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 7; Thioredoxin-regulated beta-amylase; TR-BAMY; BMY7; TRBAMY)

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAETYGKPEWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI3-kinase p85-alpha, phosphorylated (Tyr607)
403564-01 50 µL

PI3-kinase p85-alpha, phosphorylated (Tyr607)

Sign In for Pricing
View Details
PI3-kinase p85-alpha, phosphorylated (Tyr607)
403564-02 100 µL

PI3-kinase p85-alpha, phosphorylated (Tyr607)

Sign In for Pricing
View Details
GGT1 Polyclonal Antibody Bio Conjugated
MBS9463538-01 0.1 mL

GGT1 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
GGT1 Polyclonal Antibody Bio Conjugated
MBS9463538-02 5x 0.1 mL

GGT1 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS614292 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
Mouse Monoclonal Signal sequence receptor delta Antibody (26G5) [Alexa Fluor 405]
NBP2-42656AF405 100 µL

Mouse Monoclonal Signal sequence receptor delta Antibody (26G5) [Alexa Fluor 405]

Sign In for Pricing
View Details