Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Egl nine homolog 1 (EGLN1), partial

Recombinant Human Egl nine homolog 1 (EGLN1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: EGLN1. Target Synonyms: Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2; HIF-prolyl hydroxylase 2; HPH-2; Prolyl hydroxylase domain-containing protein 2; PHD2; SM-20; C1orf12; PNAS-118; PNAS-137) . Accession Number: Q9GZT9. Expression Region: 177~426aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 35.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Egl nine homolog 1 (EGLN1), partial is a purified Recombinant Protein.

Accession Number

Q9GZT9

Expression Region

177~426aa

Host

E. coli

Target

EGLN1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2; HIF-prolyl hydroxylase 2; HPH-2; Prolyl hydroxylase domain-containing protein 2; PHD2; SM-20; C1orf12; PNAS-118; PNAS-137)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TCF-12/HTF4 Antibody [Janelia Fluor 646]
NB100-2338JF646 0.1 mL

Rabbit Polyclonal TCF-12/HTF4 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Gss (NM_012962) Rat Tagged Lenti ORF Clone
RR212142L3 10 µg

Gss (NM_012962) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tropomodulin 2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62294R-BF488-01 20 µL

Tropomodulin 2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Tropomodulin 2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62294R-BF488-02 100 µL

Tropomodulin 2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Prkg1 (NM_001013833) Mouse Untagged Clone
MC220322 10 µg

Prkg1 (NM_001013833) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Twin-arginine leader-binding protein DmsD (dmsD)
MBS1324305-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi A Twin-arginine leader-binding protein DmsD (dmsD)

Sign In for Pricing
View Details