Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Egl nine homolog 1 (EGLN1), partial

Recombinant Human Egl nine homolog 1 (EGLN1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: EGLN1. Target Synonyms: Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2; HIF-prolyl hydroxylase 2; HPH-2; Prolyl hydroxylase domain-containing protein 2; PHD2; SM-20; C1orf12; PNAS-118; PNAS-137) . Accession Number: Q9GZT9. Expression Region: 177~426aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 35.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Egl nine homolog 1 (EGLN1), partial is a purified Recombinant Protein.

Accession Number

Q9GZT9

Expression Region

177~426aa

Host

E. coli

Target

EGLN1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2; HIF-prolyl hydroxylase 2; HPH-2; Prolyl hydroxylase domain-containing protein 2; PHD2; SM-20; C1orf12; PNAS-118; PNAS-137)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNF4a (Hepatocyte Nuclear Factor 4 α) Rat ELISA Kit
E0808 96 Tests

HNF4a (Hepatocyte Nuclear Factor 4 α) Rat ELISA Kit

Sign In for Pricing
View Details
MIR6907 Mouse qPCR Template Standard (MI0022754)
MK300890 200 Reactions

MIR6907 Mouse qPCR Template Standard (MI0022754)

Sign In for Pricing
View Details
CD59 Rabbit pAb
E47R1638 100 µL

CD59 Rabbit pAb

Sign In for Pricing
View Details
RN5S87 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV743303 1.0 µg DNA

RN5S87 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Monoclonal ARNT/HIF-1 beta Antibody (H1beta234) [DyLight 594]
NB100-124DL594 0.1 mL

Mouse Monoclonal ARNT/HIF-1 beta Antibody (H1beta234) [DyLight 594]

Sign In for Pricing
View Details
HDAC8 (NM_001166418) Human Over-expression Lysate
LY432831 100 µg

HDAC8 (NM_001166418) Human Over-expression Lysate

Sign In for Pricing
View Details