Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1)

Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Echs1. Target Synonyms: Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase; SCEH) . Accession Number: Q8BH95. Expression Region: 28~290aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) is a purified Recombinant Protein.

Accession Number

Q8BH95

Expression Region

28~290aa

Host

E. coli

Target

Echs1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase; SCEH)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zinc finger protein 13, Zfp13 ELISA KIT
ELI-35460m 96 Tests

Mouse Zinc finger protein 13, Zfp13 ELISA KIT

Sign In for Pricing
View Details
Kahweol oleate
MBS5814017 Inquire

Kahweol oleate

Sign In for Pricing
View Details
RDH10 CRISPR Knock Out 293T Cell Line (Human)
38764141 1x 10^6 Cells / 1.0 mL

RDH10 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
CXCR2 (Phospho-S347) Blocking Peptide
orb392965-01 1 mg

CXCR2 (Phospho-S347) Blocking Peptide

Sign In for Pricing
View Details
CXCR2 (Phospho-S347) Blocking Peptide
orb392965-02 5 mg

CXCR2 (Phospho-S347) Blocking Peptide

Sign In for Pricing
View Details
AURKA Mouse mAb
E2220527 100 µL

AURKA Mouse mAb

Sign In for Pricing
View Details