Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial

Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HEATR6. Target Synonyms: Amplified in breast cancer protein 1ABC1. Accession Number: Q6AI08. Expression Region: 1052~1175aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial is a purified Recombinant Protein.

Accession Number

Q6AI08

Expression Region

1052~1175aa

Host

E. coli

Target

HEATR6

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Amplified in breast cancer protein 1ABC1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Traf3ip2 (NM_134000) Mouse Tagged ORF Clone
MG208800 10 µg

Traf3ip2 (NM_134000) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Msmb sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
30750116 3x 1.0 µg

Msmb sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PSV40-Rluc-FLAG-ISG20 (human) -3'UTR-mut-HSVTK-Fluc
BZ59014 1 Vial

PSV40-Rluc-FLAG-ISG20 (human) -3'UTR-mut-HSVTK-Fluc

Sign In for Pricing
View Details
AP1903
B4168-50 50 mg

AP1903

Sign In for Pricing
View Details
Purified anti-human CD124 (IL-4Rα)
GT13487 100 µg

Purified anti-human CD124 (IL-4Rα)

Sign In for Pricing
View Details
CD8a (CD8 alpha, CD8 alpha Chain, CD8 Antigen alpha Chain, CD8 Antigen alpha Polypeptide (p32), Leu2 T Lymphocyte Antigen, Leu-2, Leu2, MAL, OKT8 T cell Antigen, p32, T cell Antigen Leu2, T cell Co-receptor, T cell Surface Glycoprotein CD8 alpha Chain, T Lymphocyte Differentiation Antigen T8/Leu-2, T8 T cell Antigen) (PE)
C2259-97J2 100 µg

CD8a (CD8 alpha, CD8 alpha Chain, CD8 Antigen alpha Chain, CD8 Antigen alpha Polypeptide (p32), Leu2 T Lymphocyte Antigen, Leu-2, Leu2, MAL, OKT8 T cell Antigen, p32, T cell Antigen Leu2, T cell Co-receptor, T cell Surface Glycoprotein CD8 alpha Chain, T Lymphocyte Differentiation Antigen T8/Leu-2, T8 T cell Antigen) (PE)

Sign In for Pricing
View Details