Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial

Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HEATR6. Target Synonyms: Amplified in breast cancer protein 1ABC1. Accession Number: Q6AI08. Expression Region: 1052~1175aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial is a purified Recombinant Protein.

Accession Number

Q6AI08

Expression Region

1052~1175aa

Host

E. coli

Target

HEATR6

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Amplified in breast cancer protein 1ABC1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hivep1 (NM_001105751) Rat Untagged Clone
RN205225 10 µg

Hivep1 (NM_001105751) Rat Untagged Clone

Sign In for Pricing
View Details
Porcine uridine phosphorylase 1 (UPP1) ELISA Kit
EIA07230p 1 Kit

Porcine uridine phosphorylase 1 (UPP1) ELISA Kit

Sign In for Pricing
View Details
Cyclophilin B Monoclonal Antibody(2B10), Biotin Conjugated
UB-GEN-4451 100 µL

Cyclophilin B Monoclonal Antibody(2B10), Biotin Conjugated

Sign In for Pricing
View Details
PRRX1 Human Over-expression Lysate
orb1350573 100 µg

PRRX1 Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Complement 3bR (C3bR) ELISA Kit
EIA05095m 1 Kit

Mouse Complement 3bR (C3bR) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse STK36 Protein, His (Fc)-Avi-tagged
STK36-8811M 50 µg

Recombinant Mouse STK36 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details