Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tyrophagus putrescentiae Mite group 2 allergen Tyr p 2

Recombinant Tyrophagus putrescentiae Mite group 2 allergen Tyr p 2 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Tyrophagus putrescentiae (Mold mite) (Acarus putrescentiae) . Target Name: Tyrophagus putrescentiae Mite group 2 allergen Tyr p 2. Target Synonyms: Allergen: Typ p 2. Accession Number: O02380. Expression Region: 16~141aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 17.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Tyrophagus putrescentiae Mite group 2 allergen Tyr p 2 is a purified Recombinant Protein.

Accession Number

O02380

Expression Region

16~141aa

Host

E. coli

Target

Tyrophagus putrescentiae Mite group 2 allergen Tyr p 2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Allergen: Typ p 2

Species

Tyrophagus putrescentiae (Mold mite) (Acarus putrescentiae)

Protein Name

Recombinant Protein

AA Sequence

GQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKLLATGEHGVLACGAVNTDVKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELMO3 (Engulfment and Cell motility Protein 3) discontinued
360171-01 50 µL

ELMO3 (Engulfment and Cell motility Protein 3) discontinued

Sign In for Pricing
View Details
ELMO3 (Engulfment and Cell motility Protein 3) discontinued
360171-02 100 µL

ELMO3 (Engulfment and Cell motility Protein 3) discontinued

Sign In for Pricing
View Details
Secreted Frizzled-related Protein 5 (SFRP5) BioAssayTM ELISA Kit (Mouse) discontinued
588030 96 Tests

Secreted Frizzled-related Protein 5 (SFRP5) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Bcas2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4552507 1.0 µg DNA

Bcas2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
MSK1 Antibody
MBS9504207-01 0.05 mL

MSK1 Antibody

Sign In for Pricing
View Details
MSK1 Antibody
MBS9504207-02 0.1 mL

MSK1 Antibody

Sign In for Pricing
View Details