Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3)

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: BAM3. Target Synonyms: 1,4-alpha-D-glucan maltohydrolase (Beta-amylase 8; Chloroplast beta-amylase; CT-BMY; BMY8; CTBMY) . Accession Number: O23553. Expression Region: 50~548aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 59.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3) is a purified Recombinant Protein.

Accession Number

O23553

Expression Region

50~548aa

Host

E. coli

Target

BAM3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

59.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 8; Chloroplast beta-amylase; CT-BMY; BMY8; CTBMY)

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

EMKFTHEKTFTPEGETLEKWEKLHVLSYPHSKNDASVPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRERFEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESIGKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDSGNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGKIAENVEEAALV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mpzl3 (NM_176993) Mouse Untagged Clone
MC214425 10 µg

Mpzl3 (NM_176993) Mouse Untagged Clone

Sign In for Pricing
View Details
Rabbit Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
CK-bio-17416-01 48 Tests

Rabbit Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
Rabbit Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
CK-bio-17416-02 96 Tests

Rabbit Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
Rabbit Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
CK-bio-17416-03 5x 96 Tests

Rabbit Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
Rabbit Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
CK-bio-17416-04 10x 96 Tests

Rabbit Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
Abcb8 3'UTR GFP Stable Cell Line
TU151152 1.0 mL

Abcb8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details