Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3)

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: BAM3. Target Synonyms: 1,4-alpha-D-glucan maltohydrolase (Beta-amylase 8; Chloroplast beta-amylase; CT-BMY; BMY8; CTBMY) . Accession Number: O23553. Expression Region: 50~548aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 59.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3) is a purified Recombinant Protein.

Accession Number

O23553

Expression Region

50~548aa

Host

E. coli

Target

BAM3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

59.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 8; Chloroplast beta-amylase; CT-BMY; BMY8; CTBMY)

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

EMKFTHEKTFTPEGETLEKWEKLHVLSYPHSKNDASVPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRERFEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESIGKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDSGNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGKIAENVEEAALV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal Goat anti-Feline IgA Heavy Chain Secondary Antibody [Allophycocyanin]
NB7262APC 1 mL

Goat Polyclonal Goat anti-Feline IgA Heavy Chain Secondary Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Mouse Monoclonal Involucrin Antibody (IVRN/827) [Alexa Fluor 750]
NBP3-11480AF750 0.1 mL

Mouse Monoclonal Involucrin Antibody (IVRN/827) [Alexa Fluor 750]

Sign In for Pricing
View Details
ACAT1 (Very Long-chain Specific Acyl-CoA Dehydrogenase, Mitochondrial, VLCAD, Vlcad) discontinued
A0219-90M 100 µg

ACAT1 (Very Long-chain Specific Acyl-CoA Dehydrogenase, Mitochondrial, VLCAD, Vlcad) discontinued

Sign In for Pricing
View Details
CPEB4 sgRNA CRISPR Lentivector (Human) (Target 2)
K0499403 1.0 µg DNA

CPEB4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human RBM26 Knockout A549 cell line
GTR15419999 1 Vial

Human RBM26 Knockout A549 cell line

Sign In for Pricing
View Details
Compound NP-024700
MBS5792847 Inquire

Compound NP-024700

Sign In for Pricing
View Details