Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3)

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: BAM3. Target Synonyms: 1,4-alpha-D-glucan maltohydrolase (Beta-amylase 8; Chloroplast beta-amylase; CT-BMY; BMY8; CTBMY) . Accession Number: O23553. Expression Region: 50~548aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 59.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3) is a purified Recombinant Protein.

Accession Number

O23553

Expression Region

50~548aa

Host

E. coli

Target

BAM3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

59.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 8; Chloroplast beta-amylase; CT-BMY; BMY8; CTBMY)

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

EMKFTHEKTFTPEGETLEKWEKLHVLSYPHSKNDASVPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRERFEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESIGKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDSGNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGKIAENVEEAALV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Llgl2 ORF Vector (Rat) (pORF)
ORF069433 1.0 µg DNA

Llgl2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Oligo, ssAdapter, BamH I - Sma I (10-mer), [5'-GAT CCC CGG G -3']
O6034 33ug

Oligo, ssAdapter, BamH I - Sma I (10-mer), [5'-GAT CCC CGG G -3']

Sign In for Pricing
View Details
Human Tomoregulin-2,TMEFF2 ELISA KIT
JOT-EK3067Hu 96 wells

Human Tomoregulin-2,TMEFF2 ELISA KIT

Sign In for Pricing
View Details
NSE (Y25) (Gamma-enolase, 2-phospho-D-glycerate Hydro-lyase, Neural Enolase, Neuron-specific Enolase, NSE, Enolase 2, ENO2, NSE) (APC)
MBS6489913-01 0.2 mL

NSE (Y25) (Gamma-enolase, 2-phospho-D-glycerate Hydro-lyase, Neural Enolase, Neuron-specific Enolase, NSE, Enolase 2, ENO2, NSE) (APC)

Sign In for Pricing
View Details
NSE (Y25) (Gamma-enolase, 2-phospho-D-glycerate Hydro-lyase, Neural Enolase, Neuron-specific Enolase, NSE, Enolase 2, ENO2, NSE) (APC)
MBS6489913-02 5x 0.2 mL

NSE (Y25) (Gamma-enolase, 2-phospho-D-glycerate Hydro-lyase, Neural Enolase, Neuron-specific Enolase, NSE, Enolase 2, ENO2, NSE) (APC)

Sign In for Pricing
View Details
Germ cell-specific gene 1 protein (GSG1) Rat ELISA Kit
D6755 96 Tests

Germ cell-specific gene 1 protein (GSG1) Rat ELISA Kit

Sign In for Pricing
View Details