Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3)

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: BAM3. Target Synonyms: 1,4-alpha-D-glucan maltohydrolase (Beta-amylase 8; Chloroplast beta-amylase; CT-BMY; BMY8; CTBMY) . Accession Number: O23553. Expression Region: 50~548aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 59.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3) is a purified Recombinant Protein.

Accession Number

O23553

Expression Region

50~548aa

Host

E. coli

Target

BAM3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

59.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 8; Chloroplast beta-amylase; CT-BMY; BMY8; CTBMY)

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

EMKFTHEKTFTPEGETLEKWEKLHVLSYPHSKNDASVPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRERFEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESIGKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDSGNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGKIAENVEEAALV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESAM Antibody
C43645-01 50 μL

ESAM Antibody

Sign In for Pricing
View Details
ESAM Antibody
C43645-02 100 µL

ESAM Antibody

Sign In for Pricing
View Details
Recombinant Human AIP/ARA9 Protein
NBP1-72382-0.5mg 0.5 mg

Recombinant Human AIP/ARA9 Protein

Sign In for Pricing
View Details
Kv4.3 (KCND3) CytoSection
TS422757P5 25 Slides

Kv4.3 (KCND3) CytoSection

Sign In for Pricing
View Details
Mouse Monoclonal Helicobacter Pylori Antibody (HP/1336) [CoraFluor 1]
NBP3-08499CL1 0.1 mL

Mouse Monoclonal Helicobacter Pylori Antibody (HP/1336) [CoraFluor 1]

Sign In for Pricing
View Details
PDE6H (NM_006205) Human Over-expression Lysate
LS005149-100ug 100 µg

PDE6H (NM_006205) Human Over-expression Lysate

Sign In for Pricing
View Details