Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3)

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: BAM3. Target Synonyms: 1,4-alpha-D-glucan maltohydrolase (Beta-amylase 8; Chloroplast beta-amylase; CT-BMY; BMY8; CTBMY) . Accession Number: O23553. Expression Region: 50~548aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 59.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arabidopsis thaliana Beta-amylase 3, chloroplastic (BAM3) is a purified Recombinant Protein.

Accession Number

O23553

Expression Region

50~548aa

Host

E. coli

Target

BAM3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

59.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 8; Chloroplast beta-amylase; CT-BMY; BMY8; CTBMY)

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

EMKFTHEKTFTPEGETLEKWEKLHVLSYPHSKNDASVPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRERFEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESIGKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDSGNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGKIAENVEEAALV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human REEP5 (Receptor accessory protein 5) for Antibody Discovery
MP0987J Each

Magic™ Membrane Protein Human REEP5 (Receptor accessory protein 5) for Antibody Discovery

Sign In for Pricing
View Details
Rabbit Polyclonal DR1 Antibody
NBP2-47480 0.1 mL

Rabbit Polyclonal DR1 Antibody

Sign In for Pricing
View Details
Pcgf3 sgRNA CRISPR Lentivector set (Rat)
K6518301 3x 1.0 µg

Pcgf3 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse Glucose transporter 3 (GLUT3) ELISA Kit
YP-W28197-01 48 Tests

Mouse Glucose transporter 3 (GLUT3) ELISA Kit

Sign In for Pricing
View Details
Mouse Glucose transporter 3 (GLUT3) ELISA Kit
YP-W28197-02 96 Tests

Mouse Glucose transporter 3 (GLUT3) ELISA Kit

Sign In for Pricing
View Details
C1AS1 rabbit pAb
MBS8599612-01 0.1 mL

C1AS1 rabbit pAb

Sign In for Pricing
View Details