Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Plasmodium falciparum Plasmepsin-1

Recombinant Plasmodium falciparum Plasmepsin-1 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Plasmodium falciparum. Target Name: Plasmodium falciparum Plasmepsin-1. Target Synonyms: Aspartic hemoglobinase I (PfAPG) . Accession Number: P39898. Expression Region: 125~452aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 41.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Plasmodium falciparum Plasmepsin-1 is a purified Recombinant Protein.

Accession Number

P39898

Expression Region

125~452aa

Host

E. coli

Target

Plasmodium falciparum Plasmepsin-1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aspartic hemoglobinase I (PfAPG)

Species

Plasmodium falciparum

Protein Name

Recombinant Protein

AA Sequence

AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAJ29 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV787402 1.0 µg DNA

TRAJ29 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Human, Rat, Mouse ANXA1 antibody
P1032 100ul

Human, Rat, Mouse ANXA1 antibody

Sign In for Pricing
View Details
ARFGAP3 Peptide - N-terminal region
orb2011743 100 µg

ARFGAP3 Peptide - N-terminal region

Sign In for Pricing
View Details
Zfp18 3'UTR GFP Stable Cell Line
TU273667 1.0 mL

Zfp18 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Stim1 (F-2) : m-IgG1 BP-HRP Bundle
sc-545623 1 Kit

Stim1 (F-2) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant Human CYB5B Protein, N-GST & C-His
orb3055917-01 50 µg

Recombinant Human CYB5B Protein, N-GST & C-His

Sign In for Pricing
View Details