Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus A Outer capsid protein VP4

Recombinant Rotavirus A Outer capsid protein VP4 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rotavirus A (strain RVA/Cow/United States/NCDV-Lincoln/1969/G6P6[1]) (RV-A) (Rotavirus A (strain Nebraska calf diarrhea virus) ) . Target Name: Rotavirus A Outer capsid protein VP4. Target Synonyms: Hemagglutinin. Accession Number: P17465. Expression Region: 248~480aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rotavirus A Outer capsid protein VP4 is a purified Recombinant Protein.

Accession Number

P17465

Expression Region

248~480aa

Host

E. coli

Target

Rotavirus A Outer capsid protein VP4

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hemagglutinin

Species

Rotavirus A (strain RVA/Cow/United States/NCDV-Lincoln/1969/G6P6[1]) (RV-A) (Rotavirus A (strain Nebraska calf diarrhea virus) )

Protein Name

Recombinant Protein

AA Sequence

AQPNQDIVVSKTSLWKEMQYNRDIVIRFKFANSIIKSGGLGYKWSEVSFKPANYQYTYTRDGEEVTAHTTCSVNGINDFNYNGGSLPTDFVISKYEVIKENSFVYIDYWDDSQAFRNMVNVRSLAADLNSVMCTGGDYSFALPVGNYPVMTGGAVSLHSAGVTLSTQFTDFVSLNSLRFRFRLSVEEPPFSILRTRVSGLYGLPAARPNNSQEYYEIAGRFSLISLVPSNDDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCSK1 Antibody
GWB-ML697D 50 µg

PCSK1 Antibody

Sign In for Pricing
View Details
HRT2 Conjugated Antibody
orb1616326 100 µL

HRT2 Conjugated Antibody

Sign In for Pricing
View Details
Pcdhb7-set siRNA/shRNA/RNAi Lentivector (Mouse)
36159094 4x 500 ng

Pcdhb7-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rat Glycosylated hemoglobin A1c ELISA Kit
orb1660849 96 Tests

Rat Glycosylated hemoglobin A1c ELISA Kit

Sign In for Pricing
View Details
Delta MSH Peptide
abx266331-01 5 mg

Delta MSH Peptide

Sign In for Pricing
View Details
Delta MSH Peptide
abx266331-02 10 mg

Delta MSH Peptide

Sign In for Pricing
View Details