Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) . Target Name: L. Target Synonyms: Large structural proteinReplicaseTranscriptase. Accession Number: Q05318. Expression Region: 625~809aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein.

Accession Number

Q05318

Expression Region

625~809aa

Host

E. coli

Target

L

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Large structural proteinReplicaseTranscriptase

Species

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Protein Name

Recombinant Protein

AA Sequence

RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIMP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2470005 3x 1.0 µg

TRIMP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
2310008H09Rik Protein Vector (Mouse) (pPM-C-HA)
PV147956 500 ng

2310008H09Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TNK2 Stable Ba/F3 Cell Line
T3119 1x106 cells / 1.0 mL

TNK2 Stable Ba/F3 Cell Line

Sign In for Pricing
View Details
Ctag2l2 Mouse shRNA Plasmid (Locus ID 628518)
TL518354 1 Kit

Ctag2l2 Mouse shRNA Plasmid (Locus ID 628518)

Sign In for Pricing
View Details
Gm17495 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3809403 1.0 µg DNA

Gm17495 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
T-1101 tosylate
M21658-01 1 g

T-1101 tosylate

Sign In for Pricing
View Details