Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Danio rerio (Zebrafish) (Brachydanio rerio) . Target Name: tnfb. Target Synonyms: tnfTNF alpha. Accession Number: Q4W898. Expression Region: 101~242aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial is a purified Recombinant Protein.

Accession Number

Q4W898

Expression Region

101~242aa

Host

E. coli

Target

Tnfb

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TnfTNF alpha

Species

Zebrafish (Danio rerio; Brachydanio rerio)

Protein Name

Recombinant Protein

AA Sequence

AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VIPR2, NT (VIPR2, VIP2R, Vasoactive intestinal polypeptide receptor 2, Helodermin-preferring VIP receptor, Pituitary adenylate cyclase-activating polypeptide type III receptor, VPAC2) (APC) discontinued
043759-APC 200 µL

VIPR2, NT (VIPR2, VIP2R, Vasoactive intestinal polypeptide receptor 2, Helodermin-preferring VIP receptor, Pituitary adenylate cyclase-activating polypeptide type III receptor, VPAC2) (APC) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal EXOC2 Antibody
NBP3-37953-100ul 100 µL

Rabbit Polyclonal EXOC2 Antibody

Sign In for Pricing
View Details
GDF-8/11 (H-9) Alexa Fluor® 594
sc-393335 AF594 200 µg/mL

GDF-8/11 (H-9) Alexa Fluor® 594

Sign In for Pricing
View Details
Phospho-TrkB (Tyr817) Recombinant Antibody, Cy3 Conjugated
bsm-52213R-Cy3 100 µL

Phospho-TrkB (Tyr817) Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
KLHL8 (NM_001292006) Human Untagged Clone
SC336720 10 µg

KLHL8 (NM_001292006) Human Untagged Clone

Sign In for Pricing
View Details
Ric8b Mouse shRNA Plasmid (Locus ID 237422)
TL507191 1 Kit

Ric8b Mouse shRNA Plasmid (Locus ID 237422)

Sign In for Pricing
View Details