Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Danio rerio (Zebrafish) (Brachydanio rerio) . Target Name: tnfb. Target Synonyms: tnfTNF alpha. Accession Number: Q4W898. Expression Region: 101~242aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial is a purified Recombinant Protein.

Accession Number

Q4W898

Expression Region

101~242aa

Host

E. coli

Target

Tnfb

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TnfTNF alpha

Species

Zebrafish (Danio rerio; Brachydanio rerio)

Protein Name

Recombinant Protein

AA Sequence

AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF3B5 Protein Lysate (Rat) with C-HA Tag
43573036 100 µg

SF3B5 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Biliverdin Reductase (BLVRA) (NM_000712) Human Tagged ORF Clone Lentiviral Particle
RC203243L2V 200 µL

Biliverdin Reductase (BLVRA) (NM_000712) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Arf5 shRNA (UAS) - Lentiviral mouse Arf5 shRNA (UAS) (100)
GTR15228762 1 Vial

Lentiviral mouse Arf5 shRNA (UAS) - Lentiviral mouse Arf5 shRNA (UAS) (100)

Sign In for Pricing
View Details
Rat ZNF467 shRNA Plasmid
abx990954-01 150 µg

Rat ZNF467 shRNA Plasmid

Sign In for Pricing
View Details
Rat ZNF467 shRNA Plasmid
abx990954-02 300 µg

Rat ZNF467 shRNA Plasmid

Sign In for Pricing
View Details
LOC259244 3'UTR GFP Stable Cell Line
TU259821 1.0 mL

LOC259244 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details