Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Danio rerio (Zebrafish) (Brachydanio rerio) . Target Name: tnfb. Target Synonyms: tnfTNF alpha. Accession Number: Q4W898. Expression Region: 101~242aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial is a purified Recombinant Protein.

Accession Number

Q4W898

Expression Region

101~242aa

Host

E. coli

Target

Tnfb

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TnfTNF alpha

Species

Zebrafish (Danio rerio; Brachydanio rerio)

Protein Name

Recombinant Protein

AA Sequence

AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
SR302441 2 nmol

IRAK1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Sign In for Pricing
View Details
Human Complement 5 a (C5a) ELISA Kit
NSL2235Hu 96 Tests

Human Complement 5 a (C5a) ELISA Kit

Sign In for Pricing
View Details
Mouse Gjd2 Pre-designed siRNA Set B
SI105454B 1 Each

Mouse Gjd2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
IFIH1 (Interferon-induced Helicase C Domain-containing Protein 1, MDA5) (PE) discontinued
214909-PE 100 µL

IFIH1 (Interferon-induced Helicase C Domain-containing Protein 1, MDA5) (PE) discontinued

Sign In for Pricing
View Details
α1-Microglobulin, α1- mg
E62K015 100 µg

α1-Microglobulin, α1- mg

Sign In for Pricing
View Details
S-Nitroso-N-propionyl-D, L-penicillamine (SNPP) discontinued
N2645-25G 10 mg

S-Nitroso-N-propionyl-D, L-penicillamine (SNPP) discontinued

Sign In for Pricing
View Details