Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Danio rerio (Zebrafish) (Brachydanio rerio) . Target Name: tnfb. Target Synonyms: tnfTNF alpha. Accession Number: Q4W898. Expression Region: 101~242aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Danio rerio Tumor necrosis factor (TNF superfamily, member 2) (tnfb), partial is a purified Recombinant Protein.

Accession Number

Q4W898

Expression Region

101~242aa

Host

E. coli

Target

Tnfb

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TnfTNF alpha

Species

Zebrafish (Danio rerio; Brachydanio rerio)

Protein Name

Recombinant Protein

AA Sequence

AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibroblast Growth Factor 17 (FGF17) (MaxLight 490)
MBS6476341-01 0.1 mL

Fibroblast Growth Factor 17 (FGF17) (MaxLight 490)

Sign In for Pricing
View Details
Fibroblast Growth Factor 17 (FGF17) (MaxLight 490)
MBS6476341-02 5x 0.1 mL

Fibroblast Growth Factor 17 (FGF17) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Human ACTRT3 Protein, His (Fc)-Avi-tagged
ACTRT3-2420H 50 µg

Recombinant Human ACTRT3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mouse Monoclonal MAGEB1 Antibody (OTI4E12) [HRP]
NBP2-72573H 0.1 mL

Mouse Monoclonal MAGEB1 Antibody (OTI4E12) [HRP]

Sign In for Pricing
View Details
Nlrx1 (NM_001163743) Mouse Tagged ORF Clone Lentiviral Particle
MR213673L4V 200 µL

Nlrx1 (NM_001163743) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
WFDC3 (NM_080614) Human Over-expression Lysate
LH13448V 100 µg

WFDC3 (NM_080614) Human Over-expression Lysate

Sign In for Pricing
View Details