Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Regenerating islet-derived protein 3-alpha (Reg3a)

Recombinant Rat Regenerating islet-derived protein 3-alpha (Reg3a) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Reg3a. Target Synonyms: Islet of Langerhans regenerating protein 3; REG 3Lithostathine 3; Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha; Reg III-alpha. Accession Number: P35231. Expression Region: 26~174aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 20.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Regenerating islet-derived protein 3-alpha (Reg3a) is a purified Recombinant Protein.

Accession Number

P35231

Expression Region

26~174aa

Host

E. coli

Target

Reg3a

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Islet of Langerhans regenerating protein 3; REG 3Lithostathine 3; Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha; Reg III-alpha

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protease and phosphatase inhibitor cocktail for bacterial cell extracts, 50X
P1065 2 mL Each

Protease and phosphatase inhibitor cocktail for bacterial cell extracts, 50X

Sign In for Pricing
View Details
Lentiviral human REEP4 shRNA (UAS) - Lentiviral human REEP4 shRNA (UAS, iRFP) plasmid
GTR15319639 1 Vial

Lentiviral human REEP4 shRNA (UAS) - Lentiviral human REEP4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
F8 polyclonal antibody
orb1721310-01 50 µL

F8 polyclonal antibody

Sign In for Pricing
View Details
F8 polyclonal antibody
orb1721310-02 100 µL

F8 polyclonal antibody

Sign In for Pricing
View Details
Recombinant Human Serine incorporator 4 (SERINC4), partial
MBS1085821-01 1 mg (E-Coli)

Recombinant Human Serine incorporator 4 (SERINC4), partial

Sign In for Pricing
View Details
Recombinant Human Serine incorporator 4 (SERINC4), partial
MBS1085821-02 1 mg (Yeast)

Recombinant Human Serine incorporator 4 (SERINC4), partial

Sign In for Pricing
View Details