Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Regenerating islet-derived protein 3-alpha (Reg3a)

Recombinant Rat Regenerating islet-derived protein 3-alpha (Reg3a) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Reg3a. Target Synonyms: Islet of Langerhans regenerating protein 3; REG 3Lithostathine 3; Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha; Reg III-alpha. Accession Number: P35231. Expression Region: 26~174aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 20.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Regenerating islet-derived protein 3-alpha (Reg3a) is a purified Recombinant Protein.

Accession Number

P35231

Expression Region

26~174aa

Host

E. coli

Target

Reg3a

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Islet of Langerhans regenerating protein 3; REG 3Lithostathine 3; Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha; Reg III-alpha

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC27 sgRNA CRISPR Lentivector set (Human)
K0374701 3x 1.0 µg

CCDC27 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human CHST3 shRNA (UAS) - Lentiviral human CHST3 shRNA (UAS, RFP) (100)
GTR15346935 1 Vial

Lentiviral human CHST3 shRNA (UAS) - Lentiviral human CHST3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
GAGE12F Double Nickase Plasmid (h2)
sc-418734-NIC-2 20 µg

GAGE12F Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
PMP70 Rabbit Monoclonal Antibody
AMRe87260-01 1 Each

PMP70 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PMP70 Rabbit Monoclonal Antibody
AMRe87260-02 50 µL

PMP70 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PMP70 Rabbit Monoclonal Antibody
AMRe87260-03 100 µL

PMP70 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details