Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Regenerating islet-derived protein 3-alpha (Reg3a)

Recombinant Rat Regenerating islet-derived protein 3-alpha (Reg3a) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Reg3a. Target Synonyms: Islet of Langerhans regenerating protein 3; REG 3Lithostathine 3; Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha; Reg III-alpha. Accession Number: P35231. Expression Region: 26~174aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 20.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Regenerating islet-derived protein 3-alpha (Reg3a) is a purified Recombinant Protein.

Accession Number

P35231

Expression Region

26~174aa

Host

E. coli

Target

Reg3a

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Islet of Langerhans regenerating protein 3; REG 3Lithostathine 3; Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha; Reg III-alpha

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPSF4L Lentiviral Activation Particles (h2)
sc-416101-LAC-2 200 µL

CPSF4L Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 NSP4 Antibody Fluoro488 Conjugated
A34000-Fluoro488 100 µg/Vial

Anti-SARS-CoV-2 NSP4 Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
CENPQ, 1- 268aa, Human, His tag, E.coli
E53A01581 50 µg

CENPQ, 1- 268aa, Human, His tag, E.coli

Sign In for Pricing
View Details
Rabbit Polyclonal Cdc27 Antibody [mFluor Violet 500 SE]
NBP1-77377MFV500 0.1 mL

Rabbit Polyclonal Cdc27 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
TMEM97 Double Nickase Plasmid (m2)
sc-427284-NIC-2 20 µg

TMEM97 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Prokaryotic Human Fibroblast Growth Factor 17
RPU61908-01 50 µg

Prokaryotic Human Fibroblast Growth Factor 17

Sign In for Pricing
View Details