Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Erythropoietin (epo)

Recombinant Danio rerio Erythropoietin (epo) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Danio rerio (Zebrafish) (Brachydanio rerio) . Target Name: epo. Target Synonyms: Erythropoietin-L2. Accession Number: Q2XNF5. Expression Region: 24~183aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Danio rerio Erythropoietin (epo) is a purified Recombinant Protein.

Accession Number

Q2XNF5

Expression Region

24~183aa

Host

E. coli

Target

Epo

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Erythropoietin-L2

Species

Zebrafish (Danio rerio; Brachydanio rerio)

Protein Name

Recombinant Protein

AA Sequence

SPLRPICDLRVLDHFIKEAWDAEAAMRTCKDDCSIATNVTVPLTRVDFEVWEAMNIEEQAQEVQSGLHMLNEAIGSLQISNQTEVLQSHIDASIRNIASIRQVLRSLSIPEYVPPTSSGEDKETQKISSISELFQVHVNFLRGKARLLLANAPVCRQGVS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella cbiN Protein (aa 1-93) (strain CVM19633)
VAng-Wyb0961-inquire Inquire

Recombinant Salmonella cbiN Protein (aa 1-93) (strain CVM19633)

Sign In for Pricing
View Details
Armenian Hamster Monoclonal CTLA-4 Antibody (1B8) [mFluor Violet 610 SE]
NBP1-41000MFV610 0.1 mL

Armenian Hamster Monoclonal CTLA-4 Antibody (1B8) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
TGFBR1, ID (TGF-beta Receptor Type I, TGFR-1, Transforming Growth Factor-beta Receptor Type I, TGF-beta Type I Receptor, TbetaR-I, TGF-beta Type I Receptor, Serine/Threonine-protein Kinase Receptor R4, SKR4, Activin Receptor-like Kinase 5, ALK-5, TGF beta
MBS6503413-01 0.2 mL

TGFBR1, ID (TGF-beta Receptor Type I, TGFR-1, Transforming Growth Factor-beta Receptor Type I, TGF-beta Type I Receptor, TbetaR-I, TGF-beta Type I Receptor, Serine/Threonine-protein Kinase Receptor R4, SKR4, Activin Receptor-like Kinase 5, ALK-5, TGF beta

Sign In for Pricing
View Details
TGFBR1, ID (TGF-beta Receptor Type I, TGFR-1, Transforming Growth Factor-beta Receptor Type I, TGF-beta Type I Receptor, TbetaR-I, TGF-beta Type I Receptor, Serine/Threonine-protein Kinase Receptor R4, SKR4, Activin Receptor-like Kinase 5, ALK-5, TGF beta
MBS6503413-02 5x 0.2 mL

TGFBR1, ID (TGF-beta Receptor Type I, TGFR-1, Transforming Growth Factor-beta Receptor Type I, TGF-beta Type I Receptor, TbetaR-I, TGF-beta Type I Receptor, Serine/Threonine-protein Kinase Receptor R4, SKR4, Activin Receptor-like Kinase 5, ALK-5, TGF beta

Sign In for Pricing
View Details
VMN1R139 Adenovirus (Mouse)
49553054 1.0 mL

VMN1R139 Adenovirus (Mouse)

Sign In for Pricing
View Details
Monoclonal PSCD1 Antibody (monoclonal) (M01), Clone: 1D6
AMM07363G 0.1mg

Monoclonal PSCD1 Antibody (monoclonal) (M01), Clone: 1D6

Sign In for Pricing
View Details