Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary neurotrophic factor (CNTF)

Recombinant Human Ciliary neurotrophic factor (CNTF) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CNTF. Target Synonyms: CNTF. Accession Number: P26441. Expression Region: 1~200aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ciliary neurotrophic factor (CNTF) is a purified Recombinant Protein.

Accession Number

P26441

Expression Region

1~200aa

Host

E. coli

Target

CNTF

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CNTF

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Cytochrome P450 19 type II,CYP19A2 ELISA KIT
ELI-32100p 96 Tests

Porcine Cytochrome P450 19 type II,CYP19A2 ELISA KIT

Sign In for Pricing
View Details
Rabbit Polyclonal Aromatase Antibody [DyLight 550]
NBP2-99350R 0.1 mL

Rabbit Polyclonal Aromatase Antibody [DyLight 550]

Sign In for Pricing
View Details
OR6S1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1530304 1.0 µg DNA

OR6S1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
COL1A2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV676123 1.0 µg DNA

COL1A2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (FITC)
MBS6178832-01 0.1 mL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (FITC)

Sign In for Pricing
View Details
CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (FITC)
MBS6178832-02 5x 0.1 mL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (FITC)

Sign In for Pricing
View Details