Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CMRF35-like molecule 7 (CD300LB), partial

Recombinant Human CMRF35-like molecule 7 (CD300LB), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD300LB. Target Synonyms: CLM-7 (CD300 antigen-like family member B; CMRF35-A2; Immune receptor expressed on myeloid cells 3; IREM-3; Leukocyte mono-Ig-like receptor 5; Triggering receptor expressed on myeloid cells 5; TREM-5) . Accession Number: A8K4G0. Expression Region: 18~151aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 18.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human CMRF35-like molecule 7 (CD300LB), partial is a purified Recombinant Protein.

Accession Number

A8K4G0

Expression Region

18~151aa

Host

E. coli

Target

CD300LB

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CLM-7 (CD300 antigen-like family member B; CMRF35-A2; Immune receptor expressed on myeloid cells 3; IREM-3; Leukocyte mono-Ig-like receptor 5; Triggering receptor expressed on myeloid cells 5; TREM-5)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Exosome complex component CSL4,EXOSC1 ELISA KIT
JOT-EK2687Hu-01 96 Well

Human Exosome complex component CSL4,EXOSC1 ELISA KIT

Sign In for Pricing
View Details
Human Exosome complex component CSL4,EXOSC1 ELISA KIT
JOT-EK2687Hu-02 48 Well

Human Exosome complex component CSL4,EXOSC1 ELISA KIT

Sign In for Pricing
View Details
FAT2 Rabbit Polyclonal Antibody
MBS9514511-01 0.05 mL

FAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAT2 Rabbit Polyclonal Antibody
MBS9514511-02 0.1 mL

FAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAT2 Rabbit Polyclonal Antibody
MBS9514511-03 5x 0.1 mL

FAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RANTES Polyclonal Antibody
MBS8524983-01 0.1 mg

RANTES Polyclonal Antibody

Sign In for Pricing
View Details