Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CMRF35-like molecule 7 (CD300LB), partial

Recombinant Human CMRF35-like molecule 7 (CD300LB), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD300LB. Target Synonyms: CLM-7 (CD300 antigen-like family member B; CMRF35-A2; Immune receptor expressed on myeloid cells 3; IREM-3; Leukocyte mono-Ig-like receptor 5; Triggering receptor expressed on myeloid cells 5; TREM-5) . Accession Number: A8K4G0. Expression Region: 18~151aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 18.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human CMRF35-like molecule 7 (CD300LB), partial is a purified Recombinant Protein.

Accession Number

A8K4G0

Expression Region

18~151aa

Host

E. coli

Target

CD300LB

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CLM-7 (CD300 antigen-like family member B; CMRF35-A2; Immune receptor expressed on myeloid cells 3; IREM-3; Leukocyte mono-Ig-like receptor 5; Triggering receptor expressed on myeloid cells 5; TREM-5)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1306151 3'UTR GFP Stable Cell Line
TU267624 1.0 mL

RGD1306151 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Glucagon Like Peptide 1 (GLP-1), Competitive BioAssayTM ELISA Kit (Bovine) discontinued
350986 96 Tests

Glucagon Like Peptide 1 (GLP-1), Competitive BioAssayTM ELISA Kit (Bovine) discontinued

Sign In for Pricing
View Details
Prex2 (NM_029525) Mouse Tagged ORF Clone
MG218532 10 µg

Prex2 (NM_029525) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human RARG shRNA (UAS) - Lentiviral human RARG shRNA (UAS, iRFP) plasmid
GTR15146776 1 Vial

Lentiviral human RARG shRNA (UAS) - Lentiviral human RARG shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Monoclonal Antibody to Chemerin (CHEM)
MBS2111593-01 0.1 mL

Monoclonal Antibody to Chemerin (CHEM)

Sign In for Pricing
View Details
Monoclonal Antibody to Chemerin (CHEM)
MBS2111593-02 0.2 mL

Monoclonal Antibody to Chemerin (CHEM)

Sign In for Pricing
View Details