Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Baculoviral IAP repeat-containing protein 5 (Birc5)

Recombinant Mouse Baculoviral IAP repeat-containing protein 5 (Birc5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Birc5. Target Synonyms: Apoptosis inhibitor 4 (Apoptosis inhibitor survivin; TIAP; Api4; Iap4) . Accession Number: O70201. Expression Region: 1~140aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 22.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Baculoviral IAP repeat-containing protein 5 (Birc5) is a purified Recombinant Protein.

Accession Number

O70201

Expression Region

1~140aa

Host

E. coli

Target

Birc5

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Apoptosis inhibitor 4 (Apoptosis inhibitor survivin; TIAP; Api4; Iap4)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP3 (Rabbit PAb), CF405S conjugate, 0.1mg/mL
BNC040408-500 1x 500 µL

TIMP3 (Rabbit PAb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LEFTY2 (NM_003240) Human Over-expression Lysate
LY418816 100 µg

LEFTY2 (NM_003240) Human Over-expression Lysate

Sign In for Pricing
View Details
CDC25A (N-term) Rabbit Polyclonal Antibody
AP13254PU-N 400 µL

CDC25A (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
6-Hydroxy Bentazon-d7
TRC-H806502-1MG 1 mg

6-Hydroxy Bentazon-d7

Sign In for Pricing
View Details
PBK Rabbit Monoclonal Antibody [Clone ID: R07-0B0]
TA422069 100 µL

PBK Rabbit Monoclonal Antibody [Clone ID: R07-0B0]

Sign In for Pricing
View Details
Polystyrene AM HMBA
H10014.25G 25 g

Polystyrene AM HMBA

Sign In for Pricing
View Details