Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda)

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Aicda. Target Synonyms: Activation-induced cytidine deaminase (AID; Cytidine aminohydrolase; Aid) . Accession Number: Q9WVE0. Expression Region: 1~198aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) is a purified Recombinant Protein.

Accession Number

Q9WVE0

Expression Region

1~198aa

Host

E. coli

Target

Aicda

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activation-induced cytidine deaminase (AID; Cytidine aminohydrolase; Aid)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL22 (NM_000983) Human Tagged Lenti ORF Clone
RC208910L2 10 µg

RPL22 (NM_000983) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Spcs1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3536002 1.0 µg DNA

Spcs1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
KLC4 Knockout AGS Polyclonal Cells
ARG27131 1 Million

KLC4 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Anti-Human MYH9 Antibody (SAA1446)
RHE13201 100 μg

Anti-Human MYH9 Antibody (SAA1446)

Sign In for Pricing
View Details
Human Collagen Type III (COL3) Wide-range ELISA Kit
EKN51640 96 Tests

Human Collagen Type III (COL3) Wide-range ELISA Kit

Sign In for Pricing
View Details
CD71 Antibody (C-term) [APG02505G]
APG02505G-01 50 µL

CD71 Antibody (C-term) [APG02505G]

Sign In for Pricing
View Details