Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda)

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Aicda. Target Synonyms: Activation-induced cytidine deaminase (AID; Cytidine aminohydrolase; Aid) . Accession Number: Q9WVE0. Expression Region: 1~198aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) is a purified Recombinant Protein.

Accession Number

Q9WVE0

Expression Region

1~198aa

Host

E. coli

Target

Aicda

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activation-induced cytidine deaminase (AID; Cytidine aminohydrolase; Aid)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig receptortyrosinekinase (RTKs) ELISA Kit
EIA06305Gu 1 Kit

Guinea pig receptortyrosinekinase (RTKs) ELISA Kit

Sign In for Pricing
View Details
PSMB6 antibody
70R-19587 50 ul

PSMB6 antibody

Sign In for Pricing
View Details
MT-TY Protein Vector (Human) (pPB-C-His)
PV101918 500 ng

MT-TY Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Formic Acid 84.9% (GW)
GWN9002-F 2.5 L

Formic Acid 84.9% (GW)

Sign In for Pricing
View Details
Monoclonal p21WAF1 (Tumor Suppressor Protein) Antibody - Without BSA and Azide, Clone: HJ21
AMM00516G 0.1mg

Monoclonal p21WAF1 (Tumor Suppressor Protein) Antibody - Without BSA and Azide, Clone: HJ21

Sign In for Pricing
View Details
ZNF114 Human Gene Knockout Kit (CRISPR)
KN411927 1 Kit

ZNF114 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details