Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda)

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Aicda. Target Synonyms: Activation-induced cytidine deaminase (AID; Cytidine aminohydrolase; Aid) . Accession Number: Q9WVE0. Expression Region: 1~198aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) is a purified Recombinant Protein.

Accession Number

Q9WVE0

Expression Region

1~198aa

Host

E. coli

Target

Aicda

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activation-induced cytidine deaminase (AID; Cytidine aminohydrolase; Aid)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBR1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61366R-BF405-01 20 µL

CBR1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Request Quote
View Details
CBR1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61366R-BF405-02 100 µL

CBR1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Request Quote
View Details
CCDC34 Polyclonal Antibody, APC Conjugated
bs-8098R-APC 100 µL

CCDC34 Polyclonal Antibody, APC Conjugated

Request Quote
View Details
Mouse Monoclonal PRMT7 Antibody (PCRP-PRMT7-1A4) [Janelia Fluor 635]
NBP3-14144JF635 0.1 mL

Mouse Monoclonal PRMT7 Antibody (PCRP-PRMT7-1A4) [Janelia Fluor 635]

Request Quote
View Details
Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc)
MF-0129653-01 5 µg

Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc)

Request Quote
View Details
Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc)
MF-0129653-02 10 µg

Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc)

Request Quote
View Details