Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda)

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Aicda. Target Synonyms: Activation-induced cytidine deaminase (AID; Cytidine aminohydrolase; Aid) . Accession Number: Q9WVE0. Expression Region: 1~198aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) is a purified Recombinant Protein.

Accession Number

Q9WVE0

Expression Region

1~198aa

Host

E. coli

Target

Aicda

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activation-induced cytidine deaminase (AID; Cytidine aminohydrolase; Aid)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TADA2L AAV Vector (Human) (CMV)
46064102 1 µg

TADA2L AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
GRIM19 (NDUFA13) Human Gene Knockout Kit (CRISPR)
KN218988LP 1 Kit

GRIM19 (NDUFA13) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc36a2 sgRNA CRISPR Lentivector set (Mouse)
K3619001 3x 1.0 µg

Slc36a2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
GMCL1L Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV811860 1.0 µg DNA

GMCL1L Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Tomm22 3'UTR Luciferase Stable Cell Line
TU222295 1.0 mL

Tomm22 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal ERR alpha/NR3B1 Antibody [DyLight 594]
NBP1-47254DL594 0.1 mL

Rabbit Polyclonal ERR alpha/NR3B1 Antibody [DyLight 594]

Sign In for Pricing
View Details