Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda)

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Aicda. Target Synonyms: Activation-induced cytidine deaminase (AID; Cytidine aminohydrolase; Aid) . Accession Number: Q9WVE0. Expression Region: 1~198aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) is a purified Recombinant Protein.

Accession Number

Q9WVE0

Expression Region

1~198aa

Host

E. coli

Target

Aicda

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activation-induced cytidine deaminase (AID; Cytidine aminohydrolase; Aid)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prima RNApols ExTend GMP-Grade
PBR3 100 µL

Prima RNApols ExTend GMP-Grade

Sign In for Pricing
View Details
Complete Medium for Karpas-299 Cells
abx703863 500 mL

Complete Medium for Karpas-299 Cells

Sign In for Pricing
View Details
Triethanolamine p.A.
LC-10347.1 5 L

Triethanolamine p.A.

Sign In for Pricing
View Details
Pagr1a Mouse shRNA Lentiviral Particle (Locus ID 67278)
TL516395V 500 µL Each

Pagr1a Mouse shRNA Lentiviral Particle (Locus ID 67278)

Sign In for Pricing
View Details
HER3/ErbB3 Protein (C-His, Human)
P515660 100 µg

HER3/ErbB3 Protein (C-His, Human)

Sign In for Pricing
View Details
AGN 196996 50mg
A16294-50 50 mg

AGN 196996 50mg

Sign In for Pricing
View Details