Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kelch domain-containing protein 3 (KLHDC3)

Recombinant Human Kelch domain-containing protein 3 (KLHDC3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: KLHDC3. Target Synonyms: Protein Peas (Testis intracellular mediator protein; PEAS) . Accession Number: Q9BQ90. Expression Region: 1~382aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 47kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Kelch domain-containing protein 3 (KLHDC3) is a purified Recombinant Protein.

Accession Number

Q9BQ90

Expression Region

1~382aa

Host

Baculovirus

Target

KLHDC3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein Peas (Testis intracellular mediator protein; PEAS)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDIRWELNAMTTNSNISRPIVSSHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLK4 (MAP3K21) (N-term) Rabbit Polyclonal Antibody
AP14913PU-N 400 µL

MLK4 (MAP3K21) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse COL1A1 Protein, His Tag, low endotoxin (MALS verified)
CO1-M5243-1mg 1 mg

Mouse COL1A1 Protein, His Tag, low endotoxin (MALS verified)

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS708845 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS808867 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
PGP9.5 (UCHL1) Mouse Monoclonal Antibody [Clone ID: 3D9]
AM09027PU-S 50 µL

PGP9.5 (UCHL1) Mouse Monoclonal Antibody [Clone ID: 3D9]

Sign In for Pricing
View Details
Diglycylethylenediamine, Dihydrochloride Salt
TRC-D445995-2G 2 g

Diglycylethylenediamine, Dihydrochloride Salt

Sign In for Pricing
View Details