Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ALK and LTK ligand 1 (ALKAL1)

Recombinant Human ALK and LTK ligand 1 (ALKAL1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ALKAL1. Target Synonyms: Augmentor beta (AUG-beta; Protein FAM150A; FAM150A) . Accession Number: Q6UXT8. Expression Region: 28~129aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 15.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human ALK and LTK ligand 1 (ALKAL1) is a purified Recombinant Protein.

Accession Number

Q6UXT8

Expression Region

28~129aa

Host

Baculovirus

Target

ALKAL1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Augmentor beta (AUG-beta; Protein FAM150A; FAM150A)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-500 1x 500 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF647 conjugate, 0.1mg/mL
BNC471922-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF647 conjugate, 0.1mg/mL
BNC471878-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF488A conjugate, 0.1mg/mL
BNC881660-500 1x 500 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details