Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ALK and LTK ligand 2 (ALKAL2)

Recombinant Human ALK and LTK ligand 2 (ALKAL2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ALKAL2. Target Synonyms: Augmentor alpha (AUG-alpha; Protein FAM150B; FAM150B) . Accession Number: Q6UX46. Expression Region: 25~152aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human ALK and LTK ligand 2 (ALKAL2) is a purified Recombinant Protein.

Accession Number

Q6UX46

Expression Region

25~152aa

Host

Baculovirus

Target

ALKAL2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Augmentor alpha (AUG-alpha; Protein FAM150B; FAM150B)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ATP6V1A Antibody
NBP2-55148-25ul 25 µL

Rabbit Polyclonal ATP6V1A Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Protein lsr2 (lsr2)
MBS1042903-01 0.02 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Protein lsr2 (lsr2)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Protein lsr2 (lsr2)
MBS1042903-02 0.1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Protein lsr2 (lsr2)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Protein lsr2 (lsr2)
MBS1042903-03 0.02 mg (Yeast)

Recombinant Mycobacterium tuberculosis Protein lsr2 (lsr2)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Protein lsr2 (lsr2)
MBS1042903-04 0.1 mg (Yeast)

Recombinant Mycobacterium tuberculosis Protein lsr2 (lsr2)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Protein lsr2 (lsr2)
MBS1042903-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium tuberculosis Protein lsr2 (lsr2)

Sign In for Pricing
View Details