Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial, Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial, Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: TNFRSF1B. Target Synonyms: Tumor necrosis factor receptor 2; TNF-R2; Tumor necrosis factor receptor type II; TNF-RII; TNFR-II; p75; p80 TNF-alpha receptor; CD120b; Etanercept; TBP-2; TBPII. Accession Number: P20333. Expression Region: 23~257aa. Tag Info: C-Terminal Hfc-Tagged. Theoretical MW: 54.1kDa. Buffer: Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4 Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial, Active Protein is a purified Active Recombinant Protein.

Accession Number

P20333

Expression Region

23~257aa

Host

Mammalian Cells

Target

TNFRSF1B

Conjugation

Unconjugated

Tag

C-Terminal Hfc-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Format

Lyophilized powder

Buffer

Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

54.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Tumor necrosis factor receptor 2; TNF-R2; Tumor necrosis factor receptor type II; TNF-RII; TNFR-II; p75; p80 TNF-alpha receptor; CD120b; Etanercept; TBP-2; TBPII

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ascl3 shRNA (UAS) - Lentiviral mouse Ascl3 shRNA (UAS, GFP) plasmid
GTR15295225 1 Vial

Lentiviral mouse Ascl3 shRNA (UAS) - Lentiviral mouse Ascl3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)
MBS1006727-01 0.02 mg (E-Coli)

Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)

Sign In for Pricing
View Details
Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)
MBS1006727-02 0.1 mg (E-Coli)

Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)

Sign In for Pricing
View Details
Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)
MBS1006727-03 0.02 mg (Yeast)

Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)

Sign In for Pricing
View Details
Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)
MBS1006727-04 0.1 mg (Yeast)

Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)

Sign In for Pricing
View Details
Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)
MBS1006727-05 0.02 mg (Baculovirus)

Recombinant Rickettsia prowazekii 17 kDa surface antigen (omp)

Sign In for Pricing
View Details