Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Regulator of G-protein signaling 17 (RGS17), Active Protein

Recombinant Human Regulator of G-protein signaling 17 (RGS17), Active Protein is a purified Active Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RGS17. Target Synonyms: RGS17 (RGSZ2) . Accession Number: Q9UGC6. Expression Region: 1~210aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 51.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Regulator of G-protein signaling 17 (RGS17), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9UGC6

Expression Region

1~210aa

Host

E. coli

Target

RGS17

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Biologically Active

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

RGS17 (RGSZ2)

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Connexin 45 (GJC1, Gap Junction protein, gamma 1, 45kD, Cx45, CX45, DKFZp686P0738, Gap junction alpha-7 protein, Gap junction gamma-1 protein, GJA7)
MBS6507337-01 0.1 mg

Connexin 45 (GJC1, Gap Junction protein, gamma 1, 45kD, Cx45, CX45, DKFZp686P0738, Gap junction alpha-7 protein, Gap junction gamma-1 protein, GJA7)

Sign In for Pricing
View Details
Connexin 45 (GJC1, Gap Junction protein, gamma 1, 45kD, Cx45, CX45, DKFZp686P0738, Gap junction alpha-7 protein, Gap junction gamma-1 protein, GJA7)
MBS6507337-02 5x 0.1 mg

Connexin 45 (GJC1, Gap Junction protein, gamma 1, 45kD, Cx45, CX45, DKFZp686P0738, Gap junction alpha-7 protein, Gap junction gamma-1 protein, GJA7)

Sign In for Pricing
View Details
Aacs sgRNA CRISPR Lentivector (Rat) (Target 1)
K7106102 1.0 µg DNA

Aacs sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
SIRPB1 Protein Vector (Human) (pPM-C-His)
PV038116 500 ng

SIRPB1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
RGD1563669 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6036504 1.0 µg DNA

RGD1563669 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal Procalcitonin Antibody (14C12) [HRP]
NB100-73061H 0.2 mL

Mouse Monoclonal Procalcitonin Antibody (14C12) [HRP]

Sign In for Pricing
View Details