Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Protein I (N)

Recombinant Bovine coronavirus Protein I (N) is a purified Recombinant Protein; Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine coronavirus (strain LSU-94LSS-051) (BCoV-LSU) (BCV) . Target Name: N. Target Synonyms: Accessory protein N2; N internal ORF protein; IORF; Protein in nucleocapsid ORF. Accession Number: Q9QAR0. Expression Region: 1~207aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 24.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bovine coronavirus Protein I (N) is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

Q9QAR0

Expression Region

1~207aa

Host

E. coli

Target

N

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Accessory protein N2; N internal ORF protein; IORF; Protein in nucleocapsid ORF

Species

Bovine coronavirus (strain LSU-94LSS-051) (BCoV-LSU) (BCV)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

MASLSGPISPTNLEMFKPGVEELNPSKLLLLSNHQQGMLYPTILGSLELLSFKRERSLNLQRDKVCLLHQESQLLKLRGTGTDTTDVPLKQPMATSVNCCHDGIFTILEQDRMPKTSMAPTLTESSGSLVTRLMSIPRLTFSIGTQVAMRLFRLGFRLARYSLRVTILKAQEGLHLIPDLLHAHPVEPLVQDRAVEPILAIEPLPLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ndufb9 qPCR Primer Pair
QM31410S 200 Tests

Mouse Ndufb9 qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit Polyclonal Neurolysin Antibody
NBP3-18401 100 µg

Rabbit Polyclonal Neurolysin Antibody

Sign In for Pricing
View Details
OTUB2 Protein Vector (Human) (pPB-C-His)
PV029717 500 ng

OTUB2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Aryl Hydrocarbon Receptor Recombinant Rabbit mAb
orb2324990-01 25 µL

Aryl Hydrocarbon Receptor Recombinant Rabbit mAb

Sign In for Pricing
View Details
Aryl Hydrocarbon Receptor Recombinant Rabbit mAb
orb2324990-02 50 µL

Aryl Hydrocarbon Receptor Recombinant Rabbit mAb

Sign In for Pricing
View Details
Aryl Hydrocarbon Receptor Recombinant Rabbit mAb
orb2324990-03 100 µL

Aryl Hydrocarbon Receptor Recombinant Rabbit mAb

Sign In for Pricing
View Details