Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Protein I (N)

Recombinant Bovine coronavirus Protein I (N) is a purified Recombinant Protein; Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine coronavirus (strain LSU-94LSS-051) (BCoV-LSU) (BCV) . Target Name: N. Target Synonyms: Accessory protein N2; N internal ORF protein; IORF; Protein in nucleocapsid ORF. Accession Number: Q9QAR0. Expression Region: 1~207aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 24.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bovine coronavirus Protein I (N) is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

Q9QAR0

Expression Region

1~207aa

Host

E. coli

Target

N

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Accessory protein N2; N internal ORF protein; IORF; Protein in nucleocapsid ORF

Species

Bovine coronavirus (strain LSU-94LSS-051) (BCoV-LSU) (BCV)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

MASLSGPISPTNLEMFKPGVEELNPSKLLLLSNHQQGMLYPTILGSLELLSFKRERSLNLQRDKVCLLHQESQLLKLRGTGTDTTDVPLKQPMATSVNCCHDGIFTILEQDRMPKTSMAPTLTESSGSLVTRLMSIPRLTFSIGTQVAMRLFRLGFRLARYSLRVTILKAQEGLHLIPDLLHAHPVEPLVQDRAVEPILAIEPLPLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COMMD8 (h) : 293T Lysate
sc-113950 100 µg - 200 µL

COMMD8 (h) : 293T Lysate

Sign In for Pricing
View Details
KRT14 Antibody (Biotin)
orb751277 0.5 mL

KRT14 Antibody (Biotin)

Sign In for Pricing
View Details
hsa-miR-23a-5p miRNA Mimic
MCH01610 2x 2.5 nmol

hsa-miR-23a-5p miRNA Mimic

Sign In for Pricing
View Details
Sheep Gelson ELISA Kit
MBS006273-01 48 Well

Sheep Gelson ELISA Kit

Sign In for Pricing
View Details
Sheep Gelson ELISA Kit
MBS006273-02 96 Well

Sheep Gelson ELISA Kit

Sign In for Pricing
View Details
Sheep Gelson ELISA Kit
MBS006273-03 5x 96 Well

Sheep Gelson ELISA Kit

Sign In for Pricing
View Details