Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial

Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial is a purified Recombinant Protein; Coronavirus Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human coronavirus HKU1 (isolate N2) (HCoV-HKU1) . Target Name: S. Target Synonyms: S glycoproteinUniRule annotation; E2; Peplomer protein. Accession Number: Q14EB0. Expression Region: 310~622aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 35.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

Q14EB0

Expression Region

310~622aa

Host

E. coli

Target

S

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

S glycoproteinUniRule annotation; E2; Peplomer protein

Species

Human coronavirus HKU1 (isolate N2) (HCoV-HKU1)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

TVKPVATVYRRIPNLPDCDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLLRLVHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISSSSCQLYYSLPLVNVTINNFNPSSWNRRYGFGSFNVSSYDVVYSDHCFSVNSDFCPCADPSVVNSCVKSKPLSAICPAGTKYRHCDLDTTLYVNNWCRCSCLPDPISTYSPNTCPQKKVVVGIGEHCPGLGINEEKCGTQLNHSSCSCSPDAFLGWSFDSCISNNRCNIFSNFIFNGINSGTTCSNDLLYSNTEVSTGVCVNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

von Willebrand Factor (Factor VIII Related-Ag, Coagulation Factor VIII, Factor VIII Related Antigen, F8VWF, von Willebrand Antigen 2, von Willebrand Disease (vWD)) (Biotin)
MBS6123828-01 0.1 mL

von Willebrand Factor (Factor VIII Related-Ag, Coagulation Factor VIII, Factor VIII Related Antigen, F8VWF, von Willebrand Antigen 2, von Willebrand Disease (vWD)) (Biotin)

Sign In for Pricing
View Details
von Willebrand Factor (Factor VIII Related-Ag, Coagulation Factor VIII, Factor VIII Related Antigen, F8VWF, von Willebrand Antigen 2, von Willebrand Disease (vWD)) (Biotin)
MBS6123828-02 5x 0.1 mL

von Willebrand Factor (Factor VIII Related-Ag, Coagulation Factor VIII, Factor VIII Related Antigen, F8VWF, von Willebrand Antigen 2, von Willebrand Disease (vWD)) (Biotin)

Sign In for Pricing
View Details
Reg3b siRNA Oligos set (Mouse)
38797174 3x 5 nmol

Reg3b siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
MAP2K3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
28016156 3x 1.0 µg DNA

MAP2K3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal Anti-FZD8 Antibody (N-Terminus)
TA340708 50 µg

Rabbit Polyclonal Anti-FZD8 Antibody (N-Terminus)

Sign In for Pricing
View Details
C-Actin - Cardiac Actin Protein
OPPA01410-2UG 2 µg

C-Actin - Cardiac Actin Protein

Sign In for Pricing
View Details