Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial

Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial is a purified Recombinant Protein; Coronavirus Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human coronavirus HKU1 (isolate N2) (HCoV-HKU1) . Target Name: S. Target Synonyms: S glycoproteinUniRule annotation; E2; Peplomer protein. Accession Number: Q14EB0. Expression Region: 310~622aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 35.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

Q14EB0

Expression Region

310~622aa

Host

E. coli

Target

S

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

S glycoproteinUniRule annotation; E2; Peplomer protein

Species

Human coronavirus HKU1 (isolate N2) (HCoV-HKU1)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

TVKPVATVYRRIPNLPDCDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLLRLVHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISSSSCQLYYSLPLVNVTINNFNPSSWNRRYGFGSFNVSSYDVVYSDHCFSVNSDFCPCADPSVVNSCVKSKPLSAICPAGTKYRHCDLDTTLYVNNWCRCSCLPDPISTYSPNTCPQKKVVVGIGEHCPGLGINEEKCGTQLNHSSCSCSPDAFLGWSFDSCISNNRCNIFSNFIFNGINSGTTCSNDLLYSNTEVSTGVCVNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genesig Real-Time PCR detection kit for Piscirickettsia salmonis, Advanced
349389 1 Kit

Genesig Real-Time PCR detection kit for Piscirickettsia salmonis, Advanced

Sign In for Pricing
View Details
DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 17, P72, RH70) (MaxLight 490)
MBS6413808-01 0.1 mL

DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 17, P72, RH70) (MaxLight 490)

Sign In for Pricing
View Details
DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 17, P72, RH70) (MaxLight 490)
MBS6413808-02 5x 0.1 mL

DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Helicase 17, P72, RH70) (MaxLight 490)

Sign In for Pricing
View Details
MASTL (Microtubule Associated Serine/threonine Protein Kinase-like, FLJ14813, RP11-85G18.2, THC2) (MaxLight 405) discontinued
M2415-60-ML405 100 µL

MASTL (Microtubule Associated Serine/threonine Protein Kinase-like, FLJ14813, RP11-85G18.2, THC2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
St8sia5 (NM_013666) Mouse Tagged ORF Clone Lentiviral Particle
MR218712L3V 200 µL

St8sia5 (NM_013666) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-Bral1 Antibody (N364/10)
HA982013-01 50 µg

Anti-Bral1 Antibody (N364/10)

Sign In for Pricing
View Details