Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus 133/2005 Spike glycoprotein (S), partial

Recombinant Bat coronavirus 133/2005 Spike glycoprotein (S), partial is a purified Recombinant Protein; Coronavirus Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bat coronavirus 133/2005 (BtCoV) (BtCoV/133/2005) . Target Name: S. Target Synonyms: S glycoprotein; E2; Peplomer protein. Accession Number: Q0Q4F2. Expression Region: 372~611aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bat coronavirus 133/2005 Spike glycoprotein (S), partial is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

Q0Q4F2

Expression Region

372~611aa

Host

E. coli

Target

S

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

S glycoprotein; E2; Peplomer protein

Species

Bat coronavirus 133/2005 (BtCoV) (BtCoV/133/2005)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

EASATGTFIEQPNVTECDFSPMLTGVAPQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDAIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPTCRVMASVPDNVTITKPGAYGYISKCSRLTGVNQDIETPLYINPGEYSICRDFAPLGFSEDGQVFKRTLTQFEGGGLLIGVGTRVPMTANLEMGFVISVQYGTGTDSVCPMLDLGDSLTITNRLGKCVDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)
MBS1089869-01 0.02 mg (E-Coli)

Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)
MBS1089869-02 0.02 mg (Yeast)

Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)
MBS1089869-03 0.1 mg (E-Coli)

Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)
MBS1089869-04 0.1 mg (Yeast)

Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)
MBS1089869-05 0.02 mg (Baculovirus)

Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)
MBS1089869-06 0.02 mg (Mammalian-Cell)

Recombinant Helicobacter pylori Flagellar P-ring protein (flgI)

Sign In for Pricing
View Details