Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus HKU1 Nucleoprotein (N)

Recombinant Human coronavirus HKU1 Nucleoprotein (N) is a purified Recombinant Protein; Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human coronavirus HKU1 (isolate N1) (HCoV-HKU1) . Target Name: N. Target Synonyms: Nucleocapsid proteinNCProtein N. Accession Number: Q5MQC6. Expression Region: 1~441aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 53kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human coronavirus HKU1 Nucleoprotein (N) is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

Q5MQC6

Expression Region

1~441aa

Host

Baculovirus

Target

N

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

53kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nucleocapsid proteinNCProtein N

Species

Human coronavirus HKU1 (isolate N1) (HCoV-HKU1)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

MSYTPGHYAGSRSSSGNRSGILKKTSWADQSERNYQTFNRGRKTQPKFTVSTQPQGNTIPHYSWFSGITQFQKGRDFKFSDGQGVPIAFGVPPSEAKGYWYRHSRRSFKTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQEAIPTRFPPGTILPQGYYVEGSGRSASNSRPGSRSQSRGPNNRSLSRSNSNFRHSDSIVKPDMADEIANLVLAKLGKDSKPQQVTKQNAKEIRHKILTKPRQKRTPNKHCNVQQCFGKRGPSQNFGNAEMLKLGTNDPQFPILAELAPTPGAFFFGSKLDLVKRDSEADSPVKDVFELHYSGSIRFDSTLPGFETIMKVLEENLNAYVNSNQNTDSDSLSSKPQRKRGVKQLPEQFDSLNLSAGTQHISNDFTPEDHSLLATLDDPYVEDSVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Calcium activated potassium channel subunit β 1 (KCNMB1) ELISA kit
GTR10442072 96 Well

Goat Calcium activated potassium channel subunit β 1 (KCNMB1) ELISA kit

Sign In for Pricing
View Details
Synaptotagmin VII (SYT7) Human shRNA Plasmid Kit (Locus ID 9066)
TR308978 1 Kit

Synaptotagmin VII (SYT7) Human shRNA Plasmid Kit (Locus ID 9066)

Sign In for Pricing
View Details
Goat 4 Hydroxynonenal ELISA Kit
MBS741117-01 48 Well

Goat 4 Hydroxynonenal ELISA Kit

Sign In for Pricing
View Details
Goat 4 Hydroxynonenal ELISA Kit
MBS741117-02 96 Well

Goat 4 Hydroxynonenal ELISA Kit

Sign In for Pricing
View Details
Goat 4 Hydroxynonenal ELISA Kit
MBS741117-03 5x 96 Well

Goat 4 Hydroxynonenal ELISA Kit

Sign In for Pricing
View Details
Goat 4 Hydroxynonenal ELISA Kit
MBS741117-04 10x 96 Well

Goat 4 Hydroxynonenal ELISA Kit

Sign In for Pricing
View Details