Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)

Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9) is a purified Recombinant Protein; Coronavirus Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV) . Target Name: Nsp9. Target Synonyms: Non-structural protein 9. Accession Number: P0DTD1/YP_009742616.1. Expression Region: 1~113aa. Tag Info: C-Terminal Hfc-Flag-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9) is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

P0DTD1/YP_009742616.1

Expression Region

1~113aa

Host

Mammalian Cells

Target

Nsp9

Conjugation

Unconjugated

Tag

C-Terminal Hfc-Flag-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Non-structural protein 9

Species

Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SMIM30 sgRNA gene knockout kit - Lentiviral human SMIM30 sgRNA gene knockout kit (plasmid)
GTR15398816 1 Vial

Lentiviral human SMIM30 sgRNA gene knockout kit - Lentiviral human SMIM30 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
YIPF4 siRNA (Human)
MBS8220228-01 15 nmol

YIPF4 siRNA (Human)

Sign In for Pricing
View Details
YIPF4 siRNA (Human)
MBS8220228-02 30 nmol

YIPF4 siRNA (Human)

Sign In for Pricing
View Details
YIPF4 siRNA (Human)
MBS8220228-03 5x 30 nmol

YIPF4 siRNA (Human)

Sign In for Pricing
View Details
RNF43 3'UTR GFP Stable Cell Line
TU070049 1.0 mL

RNF43 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Beta-Defensin 115 (DEFB115) ELISA Kit
MBS9397592 Inquire

Rabbit Beta-Defensin 115 (DEFB115) ELISA Kit

Sign In for Pricing
View Details